(data stored in ACNUC1104 zone)

EMBL: CP000509.PE25

CP000509.PE25        Location/Qualifiers
FT   CDS_pept        complement(28365..29771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0025"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /note="PFAM: cell cycle protein; KEGG: fal:FRAAL6752
FT                   putative cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79575"
FT                   /db_xref="GOA:A1SCP0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP0"
FT                   /protein_id="ABL79575.1"
FT                   /translation="MSQTSSSLMGFVHRRRRGAELFLLILALAVGIGAYAAVGLGVDQE
FT                   VPADLIGYGSWLAALVIAAHVVIRFVAPYADPVLLPVVAALNGLGLAVIHRLDLAKAEA
FT                   GNFHGYAQQQLTWMTLGVVLFVITLLALRDHRVLQRFTYTSGLAAIVLLLLPMLPGIGR
FT                   TINGARIWIHLGPFSFQPGEVAKVLLVVTFAGYLVLHRDALALAGRRVLFVDLPRGRDL
FT                   GPILVMWAVSLGILVRQQDLGSSLLFFGLFLVMLYVATERGGWLVVGALMFAGGATAAY
FT                   YLFPHVQVRFDIWLHPFDYYNKNGDQAFQPVEAQFGMGWGGLIGRGFGDGDPNRVPFAE
FT                   SDFIVAAIGEELGLTAVIAVVLLYGLIVERALRTALICRDGFGKLLSTGLGSVFALQVF
FT                   VVVGGVTSLIPLTGLTTPFLSYGGSSLVANWVIVAILLRISDQARRPTPQLSDDTAAIG
FT                   DDATQVVRLS"
     atgtcccaga cgtcctccag cctgatgggg ttcgtgcacc gccgccgccg gggtgccgag        60
     ctgttcctgc tgatcctcgc gctggccgtc ggcatcggcg cgtacgccgc cgtcggcctc       120
     ggcgtggacc aggaggtccc cgcggacctg atcggctacg gcagctggtt ggccgcgctg       180
     gtgatcgccg cccacgtggt gatccggttc gtcgcgccgt acgccgaccc ggtgctgctg       240
     cccgtcgtgg ccgccctgaa cggcctcgga ctggcggtga tccaccggct cgacctcgcc       300
     aaggccgagg ccggcaactt ccacggctac gcccagcagc agctgacctg gatgacgctc       360
     ggcgtggtgc tgttcgtcat cacgctcctc gcgctgcgcg accaccgggt gctccagcgg       420
     ttcacctaca ccagcgggct cgccgcgatc gtgctgctcc tgctgccgat gctgcccggc       480
     atcgggcgca ccatcaacgg cgcccggatc tggatccacc tcggcccgtt cagcttccag       540
     cccggcgagg tcgccaaggt gctgctggtc gtcaccttcg ccggctacct ggtgctgcac       600
     cgcgacgcgc tcgcgctggc cggccggcgg gtgctgttcg tcgacctccc ccgcggccgc       660
     gacctcggcc cgatcctcgt gatgtgggcg gtcagcctcg gcatcctggt ccgccagcag       720
     gacctcggct cgagcctgct gttcttcggg ctgttcctgg tgatgctcta cgtggccacc       780
     gagcggggcg gctggctggt ggtcggcgcc ctgatgttcg cgggcggcgc gaccgcggcg       840
     tactacctct tcccccacgt ccaggtgcgc ttcgacatct ggctgcaccc gttcgactac       900
     tacaacaaga acggcgacca ggccttccag ccggtcgagg cgcagttcgg catgggttgg       960
     ggcggcctga tcggccgcgg cttcggcgac ggcgacccca accgggtgcc gttcgcggag      1020
     tccgacttca tcgtcgccgc gatcggcgag gagctcggcc tgaccgcggt catcgcggtg      1080
     gtcctcctct acgggctgat cgtcgagcgg gccctgcgca cggcgctgat ctgccgcgac      1140
     ggcttcggca agctgctgtc caccggcctc ggcagcgtgt tcgcgctcca ggtgttcgtg      1200
     gtggtcggcg gggtgaccag cctgatcccg ctgaccgggc tcaccacgcc gttcctctcg      1260
     tacggcggct cctcgctggt ggcgaactgg gtgatcgtcg cgatcctgct gcggatctcc      1320
     gaccaggccc gccgccccac accgcagctc tccgacgaca ccgccgcgat cggcgacgac      1380
     gccacccagg tggtgcgcct gtcgtga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page