(data stored in SCRATCH zone)

EMBL: CP000509.PE250

CP000509.PE250       Location/Qualifiers
FT   CDS_pept        complement(272737..274059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0255"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV5597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79800"
FT                   /db_xref="GOA:A1SDB5"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB5"
FT                   /protein_id="ABL79800.1"
FT                   /translation="MLHHAEVTATTPAPRSALAEPTTKPPGRWIAAITLASIGLWAGFF
FT                   GPIQVLLAQQAEAIAPDDKKVVLSVVLGLGAFVSVVCNPVFGAFSDRTTLRAGRRLPWI
FT                   AGGAVGGALSLLLLSVADNVVVMAIGWCGVQATLNAMLAAVTATVPDQVPVGERGRVGG
FT                   ILAVAQTVGVVGGTGIASATGSIAAGYVVTAGVLIVLTLPYCVGSRDVPLAPDELPPPF
FT                   DWGGFLRSFWVSPRRHPDFAWAWITRFLVNLGNALGLLYLLYYLQDVIGVDKDEADDRV
FT                   FLLTAIYAAVIMATTVVFGVWSDRTGKRKVFVIWSGVVGSLASLLLAVGQTWPAAVAAA
FT                   VLMGVGYGIYTSVDFALITQVLPGAEDRAKDLGVINIANALPQVFAPFIAAVILLVVEA
FT                   AGGVTETGGDRFSVGYCVLYSVAFLVAVLGSVFVTKIRSVP"
     gtgctgcacc atgcggaggt gaccgccacc acgccggcgc cgcgttccgc gctggctgag        60
     ccgacgacga agccgcccgg ccgttggatc gccgcgatca cgctggccag catcgggctc       120
     tgggccggct tcttcgggcc gatccaggtg ctgctcgccc agcaggccga ggcgatcgcc       180
     ccggacgaca agaaggtcgt cctctccgtc gtcctcggcc tcggcgcctt cgtctcggtg       240
     gtctgcaacc cggtgttcgg tgccttctcc gaccgcacca ccctgagggc cggccgacgg       300
     ctgccctgga tcgcgggggg tgccgtcggc ggggcactgt cgctgctgct cctctcggtc       360
     gccgacaacg tcgtcgtgat ggcgatcggc tggtgcggcg tgcaggcgac cctcaatgcc       420
     atgctggctg cggtcaccgc gaccgtgccc gaccaggtcc ccgtgggcga gcgcggccgg       480
     gtcggaggaa tcctcgcggt cgcccagacc gtcggcgtgg tgggcggaac cggcatcgcg       540
     tcggcgaccg gcagcatcgc ggccgggtac gtcgtcaccg ccggcgtgct gatcgtgctg       600
     acgctgccgt actgcgtcgg ctcccgcgac gtcccgctgg cccccgacga gctgccgccg       660
     ccgttcgact ggggcgggtt cctgcgttcc ttctgggtct cgccgcgccg gcacccggac       720
     ttcgcgtggg cctggatcac ccgcttcctg gtcaacctcg gcaacgcgct cggcctgctc       780
     tacctcctct actacctgca ggacgtgatc ggcgtcgaca aggacgaggc cgacgaccgg       840
     gtgttcctgc tgaccgcgat ctacgcggcc gtgatcatgg cgaccacggt cgtcttcggc       900
     gtctggagcg accggaccgg caagcgcaag gtgttcgtga tctggtccgg cgtggtcggc       960
     tcgctcgcct cgctgctgct cgcggtcggc cagacctggc ccgccgccgt ggcggcggcg      1020
     gtgctgatgg gcgtcggcta cgggatctac acctcggtcg acttcgccct gatcacccag      1080
     gtgctgcccg gcgccgagga ccgcgccaag gacctgggcg tcatcaacat cgccaacgcg      1140
     ctgccccagg tgttcgcgcc gttcatcgcc gccgtgatcc tgctggtcgt cgaggccgca      1200
     ggcggggtga ccgagaccgg cggcgaccgc ttctccgtcg gctattgcgt gctgtactcc      1260
     gtcgcgttcc tggtcgccgt cctcggctcg gtgttcgtca ccaagattcg ctcggttccg      1320
     tag                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page