(data stored in ACNUC1104 zone)

EMBL: CP000509.PE252

CP000509.PE252       Location/Qualifiers
FT   CDS_pept        complement(275612..276055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0257"
FT                   /product="Mycobacterium tuberculosis paralogous family 11"
FT                   /note="PFAM: Mycobacterium tuberculosis paralogous family
FT                   11; KEGG: sma:SAV7465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79802"
FT                   /db_xref="GOA:A1SDB7"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB7"
FT                   /protein_id="ABL79802.1"
FT                   /translation="MTLDGEYEPNPQQWVRDQVEEFEASNGQRANILMDHPEWPIVVIT
FT                   SRGATSGKLRKNPVMRVEKDGVYAAIASKGGTPEHPSWYHNFVAHPEVDLQDRSEKHSY
FT                   RARIAEGAERAEWWERAVAQYAPYAEYQEKTDREIPVFLLERV"
     atgacacttg acggcgagta cgagcccaac ccccagcaat gggtccgcga ccaggtcgag        60
     gagttcgagg cctccaacgg gcagcgcgcg aacatcctga tggaccaccc cgagtggccg       120
     atcgtggtca tcacctcgag gggcgcgacg tcaggcaagc tgcgcaagaa cccggtcatg       180
     cgggtggaga aggacggcgt ctacgccgcg atcgcctcga agggcggcac ccccgagcac       240
     ccgagctggt accacaactt cgtcgcgcac cccgaggtcg acctgcagga ccgcagcgag       300
     aagcacagct accgcgcccg gatcgccgag ggcgccgagc gcgccgagtg gtgggagcgc       360
     gccgtcgcgc agtacgcgcc gtacgccgag taccaggaga agaccgaccg cgagatcccg       420
     gtcttcctgc tcgagcgcgt ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page