(data stored in ACNUC1104 zone)

EMBL: CP000509.PE256

CP000509.PE256       Location/Qualifiers
FT   CDS_pept        280460..281875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0261"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /note="PFAM: NAD(P) transhydrogenase, beta subunit; KEGG:
FT                   mmc:Mmcs_0100 NAD(P) transhydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79806"
FT                   /db_xref="GOA:A1SDC1"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC1"
FT                   /protein_id="ABL79806.1"
FT                   /translation="MSAVSISVGAYLVASLLFILSLAGLSRHESARNGVNYGIAGMALA
FT                   LAATVGLLVHDTDEALPLVLLVVAMTVGAAIGLWRARVVAMTGMPELIALLHSFVGLAA
FT                   VLVGWNGYLHDEGLTGSLFRIHSAEVVIGVFIGAVTFTGSIVANLKLSARMKSAPLMLP
FT                   GKNAINLGALAVFAALTVWFTASPNLGVLIAVTAVALALGWHLVASIGGGDMPVVVSML
FT                   NSYSGWAAAASGFLLDNNLLIVTGALVGSSGAYLSYIMCEAMNRSFISVIAGGFGIEVA
FT                   ASGDTDYGEHHEISAEEVAELLADASSVIITPGYGMAVAQAQYPVAELTSKLRARGVDV
FT                   RFGIHPVAGRLPGHMNVLLAEAKVPYDVVLEMDEINDDFPSTDVVLVIGANDTVNPAAL
FT                   EEPGSPIAGMPVLHVWEAKDVIVFKRSMAVGYAGVQNPLFFRDNTHMLFGDAKDRVEDI
FT                   VRQLSDIPQQVSR"
     atgagtgccg taagcatctc cgtcggcgcc tacctggtcg cctcgctcct gttcatcctc        60
     agcctcgccg gcctgtcgcg ccacgagagc gcccgcaacg gcgtcaacta cggcatcgcc       120
     gggatggcgt tggcgctggc cgccaccgtc ggcctgctcg tccacgacac cgacgaggcg       180
     cttccgctgg tgctcctcgt cgtggccatg acggtcgggg cggccatcgg cctgtggcgg       240
     gcccgggtcg tcgcgatgac cggcatgccc gagctgatcg cgctgctgca ctcgttcgtc       300
     ggtctggccg cggtcctcgt gggctggaac ggctacctgc acgatgaggg gctcaccggc       360
     tcgttgttcc ggatccacag cgccgaggtc gtcatcggcg tcttcatcgg cgccgtgacg       420
     ttcaccggct cgatcgtcgc gaacctcaag ctctcggcgc gcatgaagtc ggcgccgctg       480
     atgctgcccg ggaagaacgc gatcaacctc ggcgccctgg cggtcttcgc ggctctcacc       540
     gtgtggttca ccgcctcgcc gaacctcggc gtgctgatcg ccgtgaccgc ggtcgcactc       600
     gccctgggct ggcacctggt cgcctccatc ggcggcggcg acatgccggt cgtggtgtcg       660
     atgctgaaca gctactcggg ctgggccgcg gcggcgtccg ggttcctgct cgacaacaac       720
     ctgctcatcg tgaccggcgc gctcgtcggg tcgtccggtg cctacctgtc ctacatcatg       780
     tgcgaggcga tgaaccgctc gttcatctcg gtgatcgcgg gcggcttcgg catcgaggtc       840
     gccgcgtcgg gggacaccga ctacggcgag caccacgaga tctcggccga ggaggtcgcc       900
     gagctccttg ccgacgcctc aagcgtgatc atcacccccg gctacggcat ggcggtcgcg       960
     caggcgcagt acccggtcgc cgagctcacc agcaagctgc gggcccgcgg cgtcgacgtc      1020
     cgcttcggca tccaccccgt cgccggacgg ctcccggggc acatgaacgt gctgctcgcc      1080
     gaggccaagg tgccctacga cgtcgtgctg gagatggacg agatcaacga cgacttcccg      1140
     agcaccgacg tcgtcctggt catcggcgcg aacgacaccg tcaaccccgc cgccctggag      1200
     gagccgggca gcccgatcgc cggcatgccg gtgctccacg tgtgggaggc caaggacgtc      1260
     atcgtcttca agcgctcgat ggccgtgggc tacgccggcg tgcagaaccc gctcttcttc      1320
     cgcgacaaca cccacatgct gttcggtgac gccaaggatc gggtcgagga catcgtgcgg      1380
     cagctctccg acatccccca gcaggtctcg cgctga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page