(data stored in SCRATCH zone)

EMBL: CP000509.PE257

CP000509.PE257       Location/Qualifiers
FT   CDS_pept        complement(281930..282394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79807"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC2"
FT                   /protein_id="ABL79807.1"
FT                   /translation="MTGRLSAKVLVVSPLSVEVNVTPVERTSVYDEPERVSTSTVPVVV
FT                   SRPPPSIGPCRTWSRVSVPVSGTTVAVGPATWVAAQLAVSHPRLGVPATLPRVIRAARP
FT                   ACGALACAANDTPTRPGKVATSTAAIVTLSMARTIAGKPARHRGSAAGLD"
     gtgaccggca ggctcagcgc gaaggtgctc gtggtgtcgc cgctgtcggt cgaggtgaac        60
     gtgacgcccg tggagcggac cagcgtgtac gacgagccgg aacgcgtcag caccagcacg       120
     gtgcccgtgg tggtcagcag gccaccgccc tcgatcgggc cgtgccgcac ctggagccgg       180
     gtcagcgtcc cggtctcggg gacgaccgtc gcggtcgggc ccgccacctg ggtggcggcg       240
     cagctcgccg tgtcgcaccc gaggctcggc gtaccggcca cgctcccgag ggtgatcagg       300
     gccgcgcggc cggcctgcgg cgcgctcgcc tgcgccgcca acgacacccc gaccaggccc       360
     gggaaggtcg ccaccagcac cgccgcgatc gtcaccctca gtatggcccg gaccatagcc       420
     gggaagcccg cccgccaccg cggatcggcc gccggtctgg actga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page