(data stored in ACNUC1104 zone)

EMBL: CP000509.PE258

CP000509.PE258       Location/Qualifiers
FT   CDS_pept        282485..282982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79808"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC3"
FT                   /protein_id="ABL79808.1"
FT                   /translation="MAAYGDRLLIGAGSDGGRLTVFEKVGDGPFRVLARSRAVHDFDVA
FT                   YSGREPVLAWSRGRLRQLSLVVGGRLVNTRTPTEAVALATDGRLVHVVFSTVARTTCGP
FT                   AGCLHSGVYHVGLRGRRVAIKASLVQAGSSSPFRLAADTSGRTLGVVVSRNGVTRLYQR
FT                   SF"
     atggcggcgt acggcgaccg cctgctgatc ggcgccgggt ccgacggagg ccggctcacc        60
     gtgttcgaga aggtggggga cgggccgttc cgggtgttgg cccgcagcag ggcggtccac       120
     gacttcgacg tcgcgtacag cggacgggag ccggtcctgg cctggtcccg cggccggctg       180
     cgccagctca gcctggtcgt cggcggccgg ctcgtgaaca cccggacgcc gaccgaggcg       240
     gtcgcgctgg cgaccgacgg tcggctggtg cacgtggtgt tctcgacggt ggcacggacg       300
     acgtgcggcc cggccggctg cctccacagc ggcgtctacc acgtcggcct gcgcggccgg       360
     cgggtcgcga tcaaggccag cctggtccag gccggctcct cctcgccgtt ccgcctcgcg       420
     gccgacacct ccggccggac cttgggggtg gtggtctcgc gcaacggggt gaccaggctg       480
     taccagcgca gcttctga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page