(data stored in ACNUC1104 zone)

EMBL: CP000509.PE260

CP000509.PE260       Location/Qualifiers
FT   CDS_pept        284215..284913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0265"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: sal:Sala_2748 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79810"
FT                   /db_xref="GOA:A1SDC5"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC5"
FT                   /protein_id="ABL79810.1"
FT                   /translation="MVVRIVVLTGAGISAESGLPTFRDADGLWHGHRVEEVATPEAFER
FT                   VPALVHRFYDERRAALATVRPNAAHEALARLEQALGDDLLVVTQNIDDLHERSGSRQVL
FT                   HMHGRLRSALCGSCAGHFDWVGDLGDAPPCPRCGRRELRPDVVWFGEAPYDMDRILGAV
FT                   GRADLFVSVGTSGAVYPAAGFVQYAAGQGARTLELNLVPSEGSHLFDESRHGPASRLVP
FT                   EWVAEIFDTP"
     gtggtcgtga ggatcgtcgt cctgaccggg gccgggatct ccgccgagag cgggctcccg        60
     acgttccgtg acgccgacgg actctggcac ggccaccggg tcgaggaggt cgcgacgccg       120
     gaggcgttcg agcgcgtgcc cgcgctcgtg caccggttct acgacgagcg ccgcgcggcc       180
     ctggccaccg tccggcccaa cgccgcccac gaggcgctcg cccggctcga gcaggcgctc       240
     ggggacgacc tgctcgtcgt cacccagaac atcgacgacc tccacgagcg gagcggctcg       300
     cgccaggtcc tgcacatgca cggccgactg cgctcggcgc tgtgcgggtc ctgtgccggg       360
     cacttcgact gggtcggcga cctgggcgac gcgccgccgt gcccgcggtg cggtcggcgc       420
     gagctgcgtc ccgacgtcgt gtggttcggc gaggccccct acgacatgga tcggatcctc       480
     ggcgccgtcg gccgggccga cctgttcgtg tccgtcggca cgtccggcgc ggtctacccg       540
     gccgcgggct tcgtgcagta cgccgccggc cagggcgccc gcaccctcga gctcaacctg       600
     gtcccgagcg agggcagcca cctcttcgac gagtcccgcc acgggccggc ctcccgcctc       660
     gtccccgaat gggtggccga gatcttcgat actccctga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page