(data stored in ACNUC1104 zone)

EMBL: CP000509.PE262

CP000509.PE262       Location/Qualifiers
FT   CDS_pept        complement(285767..287506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0267"
FT                   /product="maltooligosyl trehalose hydrolase"
FT                   /EC_number="3.2.1.141"
FT                   /note="KEGG: nfa:nfa18050 putative glycosyl hydrolase;
FT                   TIGRFAM: malto-oligosyltrehalose trehalohydrolase; PFAM:
FT                   alpha amylase, catalytic region; SMART: alpha amylase,
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79812"
FT                   /db_xref="GOA:A1SDC7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC7"
FT                   /protein_id="ABL79812.1"
FT                   /translation="MTHGPFDVWAPLPRRLRLAVAGETVAMRRGEGDWWTPAGPVPAGA
FT                   ELDYGYLVDDGEAPRPDPRSRRQPGGVHQLSRTFDPASYPWTDQAWTGRQLAGSVVYEL
FT                   HVGTFTPEGTFDAALEKLPHLREIGVDLVELMPVNAFNGTHNWGYDGVGWFAVHEGYGG
FT                   PAGYQRFVDGCHAAGLGVIQDVVYNHLGPSGNYLPELGPYLKQGANTWGDFLNLDGPGS
FT                   DEVRRYILDNVRMWLADYHVDGLRLDAVHALNDAGHQHLLEELAAEVAALSAHQRRPLT
FT                   LIAESDLNDTRLVRPREAGGYGLDAQWSDDFHHAVHVALTGETAGYYADFEPLSALAKV
FT                   CERGFFHDGTWSSFRGRDHGFPVDLRTMPTWRLVVCSQNHDQIGNRARGDRITEVLDDD
FT                   QLACAALLTLCGPFTPMLFMGEEWAASTPFQFFTSHPEPDLGTATAEGRIAEFERMGWD
FT                   PAVVPDPQDPATFERSKLDWAEATRGRHARMLDVYRRLARLRREHEALTDPSFGSVRCT
FT                   ADEHTRVFTMRRGDLLVAVNFGDAAATVETAAATLLFQTGAGLTLDAGRLSLPPHAGAL
FT                   VGP"
     atgacccacg gaccgttcga cgtctgggcg ccgctgcccc gccggttgcg cctggccgtc        60
     gccggcgaga ccgtcgcgat gcgccgcggc gagggcgact ggtggacccc cgcggggccg       120
     gtccctgccg gcgcagagct cgactacggc tacctcgtgg acgacggcga ggcaccgcgg       180
     cccgatccgc gctcgcgccg ccagccgggt ggggtccacc agctgtcgcg gaccttcgac       240
     cccgcgtcgt acccctggac ggaccaggcc tggaccggcc gccagctggc cggctcggtg       300
     gtctacgagc tgcacgtcgg cacgttcacg cccgagggca ccttcgacgc cgcgctcgag       360
     aagctccctc acctgcgcga gatcggcgtc gacctggtcg agctgatgcc ggtcaacgcc       420
     ttcaacggca cccacaactg gggctatgac ggcgtcggct ggttcgccgt ccacgagggg       480
     tacggcgggc ccgcgggcta ccagcgcttc gtcgacggct gccacgcggc cgggctgggc       540
     gtcatccagg acgtggtcta caaccacctc ggtccgtccg ggaactacct gccggagctc       600
     ggcccgtacc tcaagcaggg ggcgaacacc tggggcgact tcttgaacct cgacggcccg       660
     ggctcggacg aggtgcggcg ctacatcctc gacaacgtgc ggatgtggct cgcggactac       720
     cacgtcgacg gcctgcggct cgatgccgtg cacgcgctca acgacgccgg ccaccagcac       780
     ctgctcgagg agctggcggc cgaggtcgcg gccctgtccg cccaccagcg gcggccgttg       840
     acgctgatcg ccgagtccga cctcaacgac acccggctgg tccgcccgcg cgaggccggc       900
     ggctacggcc tggacgcgca gtggagcgac gacttccacc acgccgtgca cgtcgccctg       960
     accggcgaga ccgccggcta ctacgccgac ttcgagccgc tctcggcgct ggcgaaggtc      1020
     tgcgagcgcg ggttcttcca cgacggcacc tggtcgtcgt tccgcggccg cgaccacggc      1080
     ttccccgtcg acctgcgcac gatgccgacc tggcggctgg tggtctgcag ccagaaccac      1140
     gaccagatcg gcaaccgcgc ccggggcgac cggatcaccg aggtgctcga cgacgaccag      1200
     ctcgcctgcg ccgcgctgct gaccctgtgc ggaccgttca cgccgatgct gttcatgggc      1260
     gaggagtggg cggcctcgac gccgttccag ttcttcacct cccaccccga gcccgacctc      1320
     gggacggcga ccgccgaggg ccggatcgcc gagttcgagc ggatgggctg ggaccccgcc      1380
     gtcgtacccg acccccagga cccggcaacg ttcgagcgct cgaagctcga ctgggcggag      1440
     gcgacccggg gccggcacgc ccggatgctc gacgtctacc gccggttggc gcggctgcgc      1500
     cgcgagcacg aggcgctcac ggacccgtcg ttcggctcgg tgcggtgcac ggccgacgag      1560
     cacacccggg tcttcacgat gcggcgcggc gacctgctgg tcgcggtgaa cttcggcgac      1620
     gccgcggcga cggtggagac cgccgccgcg acgctgctgt tccagaccgg cgccggcctc      1680
     acgctcgacg ccggccggct gtcgctgccc ccgcacgcgg gagccctggt cggaccctga      1740
//

If you have problems or comments...

PBIL Back to PBIL home page