(data stored in ACNUC1104 zone)

EMBL: CP000509.PE264

CP000509.PE264       Location/Qualifiers
FT   CDS_pept        complement(289765..291966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0269"
FT                   /product="isoamylase"
FT                   /note="KEGG: mpa:MAP3262c GlgX_2; TIGRFAM: glycogen
FT                   debranching enzyme GlgX; PFAM: glycoside hydrolase, family
FT                   13 domain protein; alpha amylase, catalytic region; SMART:
FT                   alpha amylase, catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79814"
FT                   /db_xref="GOA:A1SDC9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC9"
FT                   /protein_id="ABL79814.1"
FT                   /translation="MQVWPGRAYPLGATFDGSGTNFALFSEVADRVELCLFDAEGSEGY
FT                   RETRVELTEVDAYVWHCYLPAVQPGQRYGYRVHGPWDPENGQRCNPNKLLLDPYAKATS
FT                   GEIDWDQSLFSYNFGDPEDSDARNDEDSAPHMTHGVVINPFFDWEGDRRLDYDYNESII
FT                   YEAHVKGLTQLHPDIPEELRGTYAALGHPAITEHLTKLGVTAIELMPVHQFIQDSTLLD
FT                   KGLRNYWGYNTLGFFAPHADYAATGQPGQQVQEFKSMVKAMHAAGIEVILDVVYNHTAE
FT                   GNHLGPTLSFKGIDNAAYYRLVEDDQRYYMDYTGTGNSLNVRHPHSLQLLMDSLRYWVT
FT                   EMHVDGFRFDLASTLAREFYDVDRLSTFFELVQQDPVVSQVKLIAEPWDIGPGGYQVGG
FT                   FPPQWTEWNGKYRDTVRDFWRGEPSLGEFASRLAGSADLYEHSGRRPVASINFVTAHDG
FT                   FTLRDLVSYDEKHNEANGEDNNDGESHNRSWNHGVEGPTDDPEILEFRAREQRNFIATL
FT                   LLSQGVPMLLHGDEMGRTQQGNNNTYAQDSELSWVHWDEADKPLVEFTAALSRLRRAHP
FT                   TFRRKRFFTGGTVRVPDGGDGDRLNDIVWLHLDGRPMEDNDWTQSDSGAGAQALGMYLN
FT                   GHGIAGRDERGGPIVDNHFLLYFNADGPAEVTLPPDEYADAWDVVVDTGGLVDDQTALA
FT                   AGSTCSMASRSLIVLREHREPEAEVDHSVAASVAQARRG"
     gtgcaggtct ggccgggacg ggcgtacccg ctcggggcga cgttcgacgg gagcgggacg        60
     aacttcgccc tcttcagcga ggtcgccgac cgcgtcgagc tgtgcctctt cgacgcagag       120
     ggctcggagg gataccggga gacccgcgtc gagctcaccg aggtcgacgc ctacgtgtgg       180
     cactgctacc tgcccgccgt acagccgggc cagcgctacg gctaccgggt acacgggccc       240
     tgggacccgg agaacggaca gcgctgcaac ccgaacaagc tgctgctcga cccgtacgcc       300
     aaggccacca gcggtgagat cgactgggac cagagcctgt tctcctacaa cttcggcgac       360
     cccgaggaca gcgacgcgcg caacgacgag gactccgccc cgcacatgac ccacggggtc       420
     gtgatcaacc ccttcttcga ctgggagggc gaccgccggc tcgactacga ctacaacgag       480
     tcgatcatct acgaggcaca cgtcaagggc ctcacgcagc tccaccccga catccccgag       540
     gagctgcggg ggacgtacgc cgccctcggg cacccggcga tcaccgagca cctgaccaag       600
     ctcggcgtga ccgcgatcga gctgatgccg gtgcaccagt tcatccagga cagcacgctg       660
     ctggacaagg gcctgcgcaa ctactggggc tacaacaccc tgggcttctt cgctccgcac       720
     gccgactatg ccgccaccgg gcagcccggc cagcaggtgc aggagttcaa gtcgatggtc       780
     aaggcgatgc acgccgcggg catcgaggtg atcctcgacg tggtctacaa ccacaccgcg       840
     gagggcaacc acctcggccc cacgctgagc ttcaagggca tcgacaacgc ggcgtactac       900
     cggctggtcg aggacgacca gcgctactac atggactaca ccggcaccgg caacagcctc       960
     aacgtgcggc acccgcactc gctgcagctg ctgatggact cgctgcggta ctgggtcacc      1020
     gagatgcacg tcgacggctt ccgcttcgac ctcgcctcga cgttggctcg cgagttctac      1080
     gacgtcgacc ggctctcgac gttcttcgag ctcgtgcagc aggacccagt ggtcagccag      1140
     gtcaagctga tcgccgagcc gtgggacatc ggccccggcg gctaccaggt cggcggcttc      1200
     ccgccgcagt ggacggagtg gaacggcaag tatcgcgaca ccgtccgcga cttctggcgc      1260
     ggcgagccgt cgctgggcga gttcgcctcg cggctcgccg ggtcggccga cctctacgag      1320
     cactccggcc gccggccggt ggccagcatc aacttcgtca ccgcccacga cggcttcacc      1380
     ctgcgcgacc tggtctccta cgacgagaag cacaacgagg cgaacggcga ggacaacaac      1440
     gacggcgaga gccacaaccg ctcgtggaac cacggtgtcg agggccccac cgacgacccc      1500
     gagatcctcg agttccgcgc ccgggagcag cgcaacttca tcgcgacgct actgctgagc      1560
     cagggcgtgc cgatgctgct ccacggcgac gagatgggcc gcacccagca gggcaacaac      1620
     aacacctacg cccaggactc cgagctgagc tgggtgcact gggacgaggc cgacaagccg      1680
     ctggtcgagt tcaccgcggc gctgtcccgg ctgcggcgcg cccatcccac gttccggcgc      1740
     aagcggttct tcaccggtgg caccgtccgg gtccccgatg ggggcgacgg cgaccggctc      1800
     aacgacatcg tctggctgca cctcgacggc cggccgatgg aggacaacga ctggacccag      1860
     tcggattccg gggcaggggc acaggccctc ggcatgtacc tcaacgggca cgggatcgcc      1920
     ggccgtgacg aacgcggcgg gccgatcgtc gacaaccact tcctgctcta cttcaacgcc      1980
     gacgggccgg ccgaggtgac cctccccccg gacgagtacg ccgacgcctg ggacgtggtc      2040
     gtcgacaccg gcggcctggt ggacgaccag accgcgttgg ccgccgggtc gacctgctcg      2100
     atggcgtcgc gcagcctgat cgtgctccgc gagcaccgcg agccggaggc cgaggtcgac      2160
     cactcggtgg cagcgtcggt cgcccaggcc cgccggggct ga                         2202
//

If you have problems or comments...

PBIL Back to PBIL home page