(data stored in ACNUC1104 zone)

EMBL: CP000509.PE266

CP000509.PE266       Location/Qualifiers
FT   CDS_pept        293627..294772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0271"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   rha:RHA1_ro08138 long-chain-acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79816"
FT                   /db_xref="GOA:A1SDD1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD1"
FT                   /protein_id="ABL79816.1"
FT                   /translation="MKRSIYDDDHEAFRDSVREFLERSVIPQVEQHAADKAIPRDFWTE
FT                   AGRQGFLGLEIPEEYGGAEAGDYRFNAVLLEELNKVNAALGSCVGIHADITAPYLVELG
FT                   TDEQKQRWLPGVAAGEVLLAIGMTEPSGGSDLAALKTTAVKDGDSWVINGSKTFITNGY
FT                   SADLVLVAARTSPEKKARGITLFAVESTAPGYSRGRKLDKIGQDESDTAELFFENVRVT
FT                   DAEIVGELDGGFIHMMQKLPQERLGCAISNVAHAKQILLETLQYAKDRKAFGQGIGSFQ
FT                   YNKFLLAELFTRIEVTEAFIDQCVVAHAAGELTPIDAAKAKWWSSQVQNEVLDHCVQLH
FT                   GGYGYMNEYRVARAWRDARVSKIWAGSNEIMKELIGRDLGL"
     atgaagcgca gcatctacga cgacgaccac gaggcgttcc gcgactcggt gcgcgagttc        60
     ctcgagcggt cggtcatccc ccaggtcgag cagcacgccg ccgacaaggc gatcccgcgg       120
     gacttctgga ccgaggccgg caggcagggc ttcctgggcc tggagatccc ggaggagtac       180
     ggcggggccg aggccggcga ctaccgcttc aacgcggtgc tcctcgagga gctgaacaag       240
     gtgaacgccg cgctcggctc gtgcgtcggc atccacgccg acatcaccgc gccctacctc       300
     gtcgagctcg gcaccgacga gcagaagcag cgctggctgc cgggcgtggc tgcgggtgag       360
     gtcctgctgg ccatcgggat gaccgagccg tccggcggct ccgacctcgc cgcgctgaag       420
     accacggccg tcaaggacgg cgactcctgg gtgatcaacg gctccaagac gttcatcacc       480
     aacggctact ccgccgacct cgtgctcgtc gcggcgcgca cgtcgccgga gaagaaggcc       540
     cgcggcatca ccctgttcgc cgtcgagtcc acggcacccg gctacagccg aggccgcaag       600
     ctcgacaaga tcggccagga cgagtccgac accgccgagc tgttcttcga gaacgtccgc       660
     gtcaccgacg ccgagatcgt cggcgagctc gacggtggct tcatccacat gatgcagaag       720
     ctgccgcagg agcggctcgg ctgtgcgatc tccaacgtcg cgcacgccaa gcagatcctc       780
     ctcgagacgc tgcagtacgc caaggaccgc aaggcgttcg gccagggcat cggctccttc       840
     cagtacaaca agttcctgct cgccgagctg ttcacccgga tcgaggtgac cgaggcgttc       900
     atcgaccagt gcgtggtggc gcacgcggcg ggcgagctca cccccatcga tgcagccaag       960
     gcgaagtggt ggagctcgca ggtgcagaac gaggtgctcg accactgtgt gcagctgcac      1020
     ggcggctacg gctacatgaa cgaataccgc gtcgcgcggg cctggcggga cgcccgggtc      1080
     tcgaagatct gggccggctc caacgagatc atgaaggagc tgatcggccg cgacctgggg      1140
     ctgtga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page