(data stored in SCRATCH zone)

EMBL: CP000509.PE269

CP000509.PE269       Location/Qualifiers
FT   CDS_pept        complement(296357..297100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0274"
FT                   /product="RelA/SpoT domain protein"
FT                   /note="PFAM: RelA/SpoT domain protein; KEGG: lxx:Lxx23800
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79819"
FT                   /db_xref="GOA:A1SDD4"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD4"
FT                   /protein_id="ABL79819.1"
FT                   /translation="MTEAGSGQGGEDLRRFMLEHRFGMDEIVTKLTILRDEFTHLRDYN
FT                   PIESVSSRLKSPESLVEKMLRKGLVLDERPSFDQIRATVTDIAGVRVVCSFVSDVYRVF
FT                   DMLVEQEDVSTVEVRDYIATPKPNGYRSLHALVEVPVFLSEGPVPVLVEVQFRTIAMDF
FT                   WASLEHKIYYKYRREVPAELLERLHDAAETAYALDATMERLHEEVRGLDELPPDVLAQL
FT                   RDGGERPDAALREALRKLGATPETA"
     gtgaccgagg cggggagcgg ccagggcggc gaggacctcc ggcggttcat gctcgagcac        60
     cggttcggca tggacgagat cgtcacgaag ctgaccatcc tgcgcgacga gttcacgcac       120
     ctgcgcgact acaacccgat cgagtcggtg tcctcgcgcc tgaagtcgcc cgagagcctc       180
     gtggagaaga tgctccgcaa gggcctggtc ctcgacgagc ggccgtcgtt cgaccagatc       240
     cgagcgacgg tcaccgacat cgccggggtc cgggtcgtct gcagcttcgt ctccgacgtc       300
     taccgggtct tcgacatgct cgtggagcag gaggacgtct cgacggtcga ggtgcgcgac       360
     tacatcgcca cgcccaagcc caacggctac cgcagcctgc acgcgctggt cgaggtgccg       420
     gtcttcctct cggaggggcc ggttcccgtg ctcgtcgagg tgcagttccg cacgatcgcg       480
     atggacttct gggccagcct cgagcacaag atctactaca agtaccgccg cgaggtcccc       540
     gccgagctgc tcgagcggct gcacgacgcc gcggagacgg cgtacgccct cgacgcgacg       600
     atggagcgcc tgcacgagga ggtacgcggc ctcgacgagc tcccaccgga cgtgctcgct       660
     cagctccgcg acggcggaga gcggcccgac gccgccctgc gggaggcgct gcgcaagctg       720
     ggcgccaccc ccgagacggc ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page