(data stored in SCRATCH zone)

EMBL: CP000509.PE271

CP000509.PE271       Location/Qualifiers
FT   CDS_pept        298300..298785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79821"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD6"
FT                   /protein_id="ABL79821.1"
FT                   /translation="MADQVDGIDFALAAYREGGAWTVQELAHDVLEDIDTLSAALRRFP
FT                   GDGGAVGMVAIEEDFFVVVRVAGPTTRVLLSDITAADEWELASSAVEFLGLPLPEDEDD
FT                   PVPAGDLDLLGDLGMHAMDMGVLLDDIDLYPDEMLSDVARRLGFGKLFDDAVGLTSA"
     atggccgacc aggtcgacgg gatcgacttc gccctcgccg cctaccggga gggcggcgcc        60
     tggaccgtcc aggagctcgc ccacgacgtc ctcgaggaca tcgacaccct ctccgccgcg       120
     ctgcgccgct tccccgggga cgggggagcg gtcgggatgg tcgcgatcga ggaggacttc       180
     ttcgtcgtgg tccgcgtcgc ggggccgacc acccgggtcc tgctctccga catcaccgcc       240
     gccgacgagt gggagctggc cagctccgcc gtcgagttcc tcggcctgcc gctgcccgag       300
     gacgaggacg acccggtccc cgcgggcgac ctggacctgc tcggcgacct cggcatgcac       360
     gccatggaca tgggcgtcct gctcgacgac atcgatctct accccgacga gatgctctcc       420
     gacgtcgcgc ggcggctggg cttcggcaag ctgttcgacg acgccgtcgg cctcacctcc       480
     gcgtga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page