(data stored in ACNUC1104 zone)

EMBL: CP000509.PE273

CP000509.PE273       Location/Qualifiers
FT   CDS_pept        299282..299674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0278"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: lxx:Lxx15560 lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79823"
FT                   /db_xref="GOA:A1SDD8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD8"
FT                   /protein_id="ABL79823.1"
FT                   /translation="MHSYRGAMDYKIELIPLAVRDVDRSIAFYGDSLGWSVDHDQTVSP
FT                   TLRFVQVTPPGSACSICFGVGLEMMPAGSSQFIQVVVADADAALAELRERGVGCEGVDD
FT                   QPWGRFVYFQDPDGNRWALQQVVRPS"
     atgcactcct accgtggcgc catggactac aagatcgagc tcatccccct cgccgttcgc        60
     gacgtcgacc ggtcgatcgc cttctacggc gactccctcg gttggagcgt cgaccacgat       120
     cagaccgtct cgccgacgct gcggttcgtg caggtgacgc cacccggctc ggcctgctcg       180
     atctgcttcg gcgtcgggct cgagatgatg ccggccggtt cgtcgcagtt catccaggtc       240
     gtggtcgccg acgcggacgc cgccctcgcc gagctgcggg agcgcggtgt cgggtgcgag       300
     ggggtcgacg accagccgtg ggggcgcttc gtgtacttcc aggaccccga cggcaaccgg       360
     tgggcgctcc agcaggtcgt ccggccgtcc tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page