(data stored in ACNUC1104 zone)

EMBL: CP000509.PE276

CP000509.PE276       Location/Qualifiers
FT   CDS_pept        302655..303251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro04896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79826"
FT                   /db_xref="GOA:A1SDE1"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE1"
FT                   /protein_id="ABL79826.1"
FT                   /translation="MNRYAAALVVALSALVAPPAHAASAHATSAAQEAWSPRPEIYPAT
FT                   VTRTDLAVPMSDGVVLRGDLVLPAGADGRAVRGRFPVIVTITAYNKTALSSGGGVAGAP
FT                   PAYLVQRGYAQLTVDARGTGSSEGQWSAFGARENEDSAEVVEWAHSRKRPWSDGRVGMS
FT                   GPITARLYTSSVSGDGMLSVSVSDVAPDGTVSRLS"
     gtgaatcggt acgccgctgc cctggtcgtc gccctctccg cgctggtcgc accgcccgcc        60
     catgccgcat ccgcccatgc cacgtccgcc gcgcaggagg cctggtctcc ccgcccggag       120
     atctacccgg cgaccgtgac ccgcaccgac ctggcggtcc cgatgtccga cggcgtggtc       180
     ctccgcggcg acctggtcct gcccgccggc gccgacgggc gggcggtccg cggccgcttc       240
     ccggtgatcg tgacgatcac ggcctacaac aagaccgcgc tctcgtccgg gggcggggtg       300
     gcgggcgcgc cgccggcgta cctggtccag cgcgggtacg cgcagctgac cgtcgacgcc       360
     cgcggcaccg gcagctccga agggcagtgg tcggcgttcg gggcccggga gaacgaggac       420
     tccgccgagg tcgtcgagtg ggcacactcg cgcaagcgcc cctggagtga cggccgggtc       480
     gggatgagcg gcccgatcac cgcgcggctg tacacctcaa gcgtgagcgg ggacgggatg       540
     ctgtcggtct cggtctccga cgtcgcgccc gatggcaccg tcagccggct gagctga          597
//

If you have problems or comments...

PBIL Back to PBIL home page