(data stored in SCRATCH zone)

EMBL: CP000509.PE278

CP000509.PE278       Location/Qualifiers
FT   CDS_pept        304562..304891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro00038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79828"
FT                   /db_xref="InterPro:IPR015057"
FT                   /db_xref="InterPro:IPR038070"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE3"
FT                   /protein_id="ABL79828.1"
FT                   /translation="MVSWDGDAVAALDRAGRGGAMHTKTWSVEIFIGEHDGQTRAEARL
FT                   ATEPSATRLTGWGIARLNPADPEVPEIGDELATARALADLAHQLLETAAVDIGAVTSKP
FT                   VHLTH"
     atggtgtcct gggacggcga cgccgtcgcc gccctcgacc gcgccggacg aggaggagcg        60
     atgcacacca agacctggtc ggtggagatc ttcatcgggg agcacgacgg tcagacccgc       120
     gccgaggcac ggctcgccac cgagccgtcg gccacccggc tgaccggatg ggggatcgcg       180
     cggctcaacc ccgccgaccc cgaggtgccg gagatcggcg acgagctcgc gaccgcgcgg       240
     gccctggccg atctggctca ccagctgctc gagaccgcgg cggtcgacat cggcgcggtg       300
     accagcaagc cggtgcacct gacccactga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page