(data stored in ACNUC1104 zone)

EMBL: CP000509.PE281

CP000509.PE281       Location/Qualifiers
FT   CDS_pept        305919..306359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79831"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE6"
FT                   /protein_id="ABL79831.1"
FT                   /translation="MRPALLALLAALLALAVAPYPQPSAAASCVAPYLVEDGQLVLQRG
FT                   VRTEVEGEAFVDGCRDTMSCSAGPGCEDCHYNDPEPVPYDDVVLRLRQGGHTWVLGSAD
FT                   ADRAEDGLAGRVSWQVDLPAGVRPGPARLLADHAHPVVVRIR"
     atgcgacccg cgctcctggc cctgctcgcc gctctgctgg cgttggcggt cgcgccgtac        60
     ccgcagccgt cggccgccgc gtcctgcgtg gcgccttacc tcgtcgagga cgggcagctc       120
     gtcctgcagc ggggggtgcg caccgaggtc gagggggagg cgttcgtgga cggctgccgc       180
     gacacgatga gctgctcggc cgggcccggg tgcgaggact gccactacaa cgaccctgag       240
     cccgtgccgt acgacgacgt cgtgctgcgg ctgcgccagg gcgggcacac ctgggtgctc       300
     ggcagcgccg acgccgaccg tgccgaggac ggcctggccg gacgggtgag ctggcaggtc       360
     gacctgccag ccggcgtacg ccccgggccg gcgaggctgc tcgccgacca cgcccacccc       420
     gtggtggtgc ggatccgctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page