(data stored in ACNUC1104 zone)

EMBL: CP000509.PE283

CP000509.PE283       Location/Qualifiers
FT   CDS_pept        306940..307707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0288"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   nfa:nfa50130 putative enoyl-CoA hydratase/isomerase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79833"
FT                   /db_xref="GOA:A1SDE8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE8"
FT                   /protein_id="ABL79833.1"
FT                   /translation="MSVRVEVDGPVTTVVLDRPETRNAVDGPTAAALAAAFRAFDEDDT
FT                   QSVAVLHGEGGTFCAGADLKSIGTERGNQVAEPIDAADGPMGPTRMRLSKPVIAAIEGY
FT                   AVAGGLELALWCDLRVAADDAVLGVFCRRWGVPLVDGGTVRLPRLIGTSRALDLILTGR
FT                   AVGAEEAERIGLVNRVVPAGRARAEAEALARSLAVLPQECLRQDRLSVLDQEGRTEAEA
FT                   LAGELRHGLVSLAADALGGAARFAAGEGRHGRF"
     gtgagcgtcc gggtcgaggt cgacgggccg gtgacgacgg tcgtgctcga ccggcccgag        60
     acccgcaacg cggtcgacgg ccccacggct gcggcgctgg ccgcggcgtt ccgggccttc       120
     gacgaggacg acacgcagag cgtggcggtg ctgcacggcg agggcggcac cttctgcgcc       180
     ggcgccgacc tcaagtcgat cggcaccgag cgcggcaacc aggtcgccga gcccatcgac       240
     gccgccgacg ggccgatggg tccgacgcgg atgcggctga gcaagccggt gatcgcggcg       300
     atcgaggggt acgccgtcgc gggcgggctg gagctggcgc tgtggtgcga cctgcgggtc       360
     gccgcggacg acgcggtcct cggggtcttc tgccggcggt ggggcgtgcc cctcgtcgac       420
     ggcggcacgg tgcggctgcc ccggctgatc ggcaccagcc gggcgctgga cctgatcctc       480
     accggtcggg ctgtcggcgc cgaggaggcc gagcggatcg gcctggtcaa ccgggtcgtc       540
     ccggccggcc gggcgcgcgc ggaggccgag gcgctggcgc gctcgctcgc cgtcctcccc       600
     caggagtgcc tgcggcagga ccggctgtcc gtgctcgacc aggagggccg gaccgaggct       660
     gaggcgctcg ccggcgagct gcggcacggg ctggtctccc tggcggccga cgccctcggc       720
     ggggccgccc ggttcgccgc cggcgagggg cgtcacggcc gcttctga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page