(data stored in SCRATCH zone)

EMBL: CP000509.PE286

CP000509.PE286       Location/Qualifiers
FT   CDS_pept        308745..309644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0291"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_5; KEGG: fal:FRAAL1932 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79836"
FT                   /db_xref="GOA:A1SDF1"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF1"
FT                   /protein_id="ABL79836.1"
FT                   /translation="MPQPNPWFATPADAAARLAGAGYLADPATATTTYLAGALEKPLLV
FT                   EGPAGVGKTELAKAVAGVTGSELVRLQCYEGLDEARALYEWNYKKQLLSIQAAAAISST
FT                   TATLTSARDLLNHEIFSEEFLLTRPLLTAIRREEPTVLLIDEVDKTDVEVEGLLLEVLS
FT                   DFQVTIPELGTVRAVRRPFVVLTSNATRELSEAVKRRCLYLHLDYPDAEREREIVGSQV
FT                   PDLDGRIAAQLVAMIGRLRDLDLKKAPSIAESVDWARTLVALEIGDLDDKVVDDTLGVV
FT                   LKHASDQERAVKELRLRK"
     atgccgcagc cgaatccgtg gttcgccacg cccgccgacg ccgccgcccg cctcgcgggc        60
     gccggctacc tcgccgaccc ggcgaccgcg acgaccacct acctcgccgg ggcactcgag       120
     aagcccctgc tcgtcgaggg gcccgccggc gtcgggaaga ccgagctcgc caaggccgtc       180
     gcaggggtga ccgggtcgga gctggtgcgg ctgcagtgct acgaggggct ggacgaggcg       240
     cgcgcgctgt acgagtggaa ctacaagaag cagctgctct ccatccaggc ggcggccgcc       300
     atctcgtcca cgaccgcaac cctgacctca gcccgagacc tcctgaacca cgagatcttc       360
     agcgaggagt tcctgctgac ccggccgctg ctgacggcga tccgtcgcga ggagccgacc       420
     gtgttgctga tcgacgaggt cgacaagacc gacgtcgagg tggaggggct gctgctcgag       480
     gtgctctcgg acttccaggt caccatcccc gagctgggca cggtgcgcgc cgtccggcgc       540
     ccgttcgtcg tgctgacctc caacgccacc cgcgagctgt ccgaggcggt caagcggcgc       600
     tgcctctacc tgcacctcga ctacccggac gccgagcggg agcgggagat cgtcggctcc       660
     caggtccccg acctcgacgg gcggatcgcg gcccagctcg tcgcgatgat cggccggctg       720
     cgcgacctgg acctcaagaa ggcgccgtcg atcgccgagt ccgtcgactg ggcgcgcacc       780
     ctggtcgccc tggagatcgg cgacctggac gacaaggtgg tcgacgacac cctgggcgtg       840
     gtgctcaagc acgcctccga ccaggagcgt gccgtcaagg agctgcggct ccggaagtga       900
//

If you have problems or comments...

PBIL Back to PBIL home page