(data stored in SCRATCH zone)

EMBL: CP000509.PE288

CP000509.PE288       Location/Qualifiers
FT   CDS_pept        complement(311035..312474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: blo:BL1804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79838"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF3"
FT                   /protein_id="ABL79838.1"
FT                   /translation="MSADITSVTGGSTGLAATYAAVRALADAYDEAGSRLRGWAALGAE
FT                   TMTNPDLAESAVLAPLTFAEAEAAVLAATTGPDGVLVESLGWEADALAVRAVVTALEAT
FT                   DALVRTAVDELDRAVGRTVGFTLGATAPALVPVLAATLPLVPPAVRRELEDRLEQWVVD
FT                   HPGVVQHAANGGGGLLEGLWDGVTPLAPGGLLGVPLLAPDTEAGAGLLALLYGPEGHAG
FT                   VSEVHPQVCTDPSQPTDLEGLVAHLAAVAGLSPEPDSPLNGTIEIQTLDAGTDGVRHIV
FT                   YLPGTDDLTTLPWTQDGDIRDGGTDLHSDAGHQTIYQQGILQAMAQAGIGPHDPVLLVG
FT                   HSLGGMEAAAILGHDSGFNVTNVVTAGAPTAQVDGFPAGSHVLSLEHHGDLVPAGDGAP
FT                   NPDTVEQTTVTFEDDPTGIVDAHGYGHYLAGAAAVDDATDPSVQEQLASLHAHGFLGDA
FT                   GGAGGPAAIVTSHVFQIVRQP"
     gtgagcgccg acatcacctc ggtcaccggc ggctcgacgg gcctggccgc cacgtacgcc        60
     gccgtccgcg cgctggccga cgcgtacgac gaggccggca gccggctgcg cggctgggcg       120
     gcgctggggg ccgagacgat gacgaacccc gacctcgccg agtccgcggt gctcgcgccg       180
     ctgacgttcg ccgaggccga ggccgcggtc ctggccgcga cgaccggccc cgacggggtc       240
     ctggtcgaat ccctcggctg ggaggccgac gcgctggcgg tgcgcgccgt cgtcaccgcg       300
     ctcgaggcga ccgacgcgct ggtgcgcacc gccgtcgacg agctcgaccg ggcggtgggc       360
     cggaccgtcg gcttcaccct gggggcgacc gcgccggcac tggtgcccgt gctcgccgcc       420
     acgctgccgc tggtgccccc ggcggtccgc cgcgagctgg aggaccggct cgagcagtgg       480
     gtggtggacc acccgggcgt ggtgcagcac gccgcgaacg gcggcggcgg cctgctcgag       540
     ggtctctggg acggcgtcac cccgctcgct ccgggcggcc tgctcggcgt acctctgctc       600
     gcccccgaca ccgaggccgg cgccggcctg ctggcactgc tctacgggcc cgagggccac       660
     gccggggtgt ccgaggtgca cccgcaggtg tgcaccgacc cgagccagcc gaccgacctc       720
     gaggggctgg tcgcccacct cgcggcggtg gccgggctct cgcccgagcc cgactccccg       780
     ctcaacggca ccatcgagat ccagacgctg gacgccggca ccgacggggt acggcacatc       840
     gtctacctgc ccgggaccga cgacctcacc accctgccct ggacccagga cggcgacatc       900
     cgcgacggcg ggaccgacct gcactccgac gccggacacc agaccatcta ccagcagggg       960
     atcctccagg cgatggcgca ggccggcatc gggccgcacg acccggtgct gctcgtcggg      1020
     cactcgctgg gcggcatgga ggcggcggcg atcctcggtc acgacagcgg cttcaacgtg      1080
     acgaacgtgg tcaccgccgg tgcccccacg gcccaggtcg acgggttccc ggccggcagc      1140
     cacgtgctct cgctcgagca tcacggtgac ctcgtgccgg ctggcgacgg cgcgcccaac      1200
     ccggacacgg tcgagcagac caccgtcacg ttcgaggacg acccgacggg catcgtggac      1260
     gcccacggct acggccacta cctcgccggg gccgcggccg tcgacgacgc caccgacccg      1320
     tcggtgcagg agcagctcgc gagcctgcac gcccacggct tcctcggcga cgcgggcgga      1380
     gcgggtgggc ccgcggccat cgtcacgagc cacgtcttcc agatcgttcg acaaccctga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page