(data stored in ACNUC1104 zone)

EMBL: CP000509.PE29

CP000509.PE29        Location/Qualifiers
FT   CDS_pept        32794..33363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0029"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; FR47 domain
FT                   protein; KEGG: sco:SCO4496 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79579"
FT                   /db_xref="GOA:A1SCP4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP4"
FT                   /protein_id="ABL79579.1"
FT                   /translation="MDACDGGPRGGYGPRVTTDLTASWPAQSTDELRAGLQGLLRDVVR
FT                   AGGAVGWLEPPGRADTDSWLDRLTAQQQAGDAGLVVIGDPVAPLAMGTWRRVDRQVHRH
FT                   VAEIAKVMSHPRARGRGLGRRVTTELLAALPAAGIEIVTLATRGNNHAAMALYTSLGFR
FT                   EYGRIPDGIMVGDDRYDDVRFVLSIE"
     gtggacgcgt gcgacggcgg cccgcggggc ggctacggtc cacgcgtgac caccgacctg        60
     acggcctcgt ggccggcgca gtcgaccgac gagctgcgag ccgggctcca gggcctcctc       120
     cgcgacgtgg tgcgcgctgg tggcgcggtc ggctggctgg agcccccggg ccgggccgac       180
     accgactcct ggctcgacag gctgacggcc cagcagcaag ccggtgacgc gggcctggtg       240
     gtgatcggcg acccggtggc tccgctggcg atgggcacct ggcgccgggt ggaccggcag       300
     gtccaccggc acgtggccga gatcgcgaag gtgatgtccc atccacgcgc ccgagggcgt       360
     ggtctcgggc ggagagtgac gaccgagctg ctcgcggccc tcccggccgc gggcatcgag       420
     atcgtcacct tggcgacgcg ggggaacaac cacgcggcga tggcgctcta tacctcgttg       480
     ggcttccgtg agtacgggcg gatccccgac ggcatcatgg tcggcgacga tcggtacgac       540
     gacgtccggt tcgtgctctc gatcgagtga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page