(data stored in ACNUC1104 zone)

EMBL: CP000509.PE291

CP000509.PE291       Location/Qualifiers
FT   CDS_pept        complement(314330..315811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0296"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: mbo:Mb1848 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79841"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF6"
FT                   /protein_id="ABL79841.1"
FT                   /translation="MGRGTDIPAVLPAELLADAPSYDVVVVGFGIAGGCAALEAARAGA
FT                   RVLLLERAAVHGGTSSLSGGHFYLGGGTAVQVATGHDDTPEEMYKYLVAVSKEPEHDKI
FT                   RAYCEGSVEHFDWLEALGFEFERTYYPEKAVIQPGTEGLMYTGNEKVWPYREQARPAPR
FT                   GHKVPVPGDTEGTRMVMDLLHERVEEAGVEVRYETGATNLVADGSGTVRGLAWRSFEET
FT                   GYVAAAGVVIAAGGFVMNPDMVAAHTPRLAEKPFTLGSTYDDGLGIRLGASAGAELKHM
FT                   DEPFITAPFYPPSALVTGFLVNKLGERFCAEDSYHSRTSQFVMEQPDSTAYLIVDSEHV
FT                   EYPKFPLVPLIDGFETISELEDALELPAGSVAKTLERYNELAEAGEDADFHKAPEWLAP
FT                   QGAGPWAVFDLRLGHAMYAGFTLGGLRVSVDGEVERPDGSVIPGLYAAGACASNIAQDG
FT                   KGYCSGTQLGEGSFFGRRSGRAAAASASAASTGSG"
     atgggcagag gcaccgacat ccccgccgtc ctcccggccg agctgctggc cgacgcgccg        60
     tcgtacgacg tcgtggtcgt cgggttcggc atcgccggtg gctgcgccgc gctcgaggcc       120
     gcgcgtgcgg gggcgcgggt gctgctcctg gagcgcgcgg cggtgcacgg cggcacctcc       180
     agcctgtccg gcggccactt ctacctcggc ggcgggacgg ccgtgcaggt ggcgaccgga       240
     cacgatgaca cccccgagga gatgtacaag tacctcgtcg ccgtctcgaa ggagcccgag       300
     cacgacaaga tccgcgccta ctgcgagggc tcggtcgagc acttcgactg gctcgaggcg       360
     ctgggcttcg agttcgagcg cacctactac cccgagaagg cggtgatcca gccggggacc       420
     gaggggctga tgtacacggg caacgagaag gtgtggccct accgggagca ggcgcggccg       480
     gcgccgcgcg gccacaaggt gccggtgccc ggggacaccg agggcaccag gatggtgatg       540
     gacctgctgc acgagcgggt cgaggaggcg ggcgtcgagg tccgctacga gaccggcgcg       600
     accaacctgg tcgccgacgg gtccggcacc gtccgcgggc tggcctggag gtccttcgag       660
     gagaccgggt acgtcgccgc cgccggggtc gtgatcgcgg ccggcggctt cgtgatgaac       720
     ccggacatgg tcgccgcgca caccccgcgg ctggcggaga agccgttcac gctggggtcg       780
     acgtacgacg acggcctcgg catccggctc ggcgcgtcgg ccggcgcgga gctcaagcac       840
     atggacgagc cgttcatcac cgcgccgttc tacccaccgt cggcgctggt caccggcttc       900
     ctcgtgaaca agctcggcga gcggttctgc gccgaggact cctaccactc gcgcacctcg       960
     cagttcgtga tggagcagcc cgactccacg gcgtacctca tcgtcgacag cgagcacgtg      1020
     gagtacccga agttcccgct ggtgccgctg atcgacggct tcgagacgat ctccgagctc      1080
     gaggacgcgc tcgagctgcc ggccgggtcg gtcgccaaga cgctggagcg ctacaacgag      1140
     ctcgccgagg ccggggagga cgccgacttc cacaaggcgc ccgagtggct ggcgccgcag      1200
     ggcgccggcc cgtgggcggt cttcgacctg cggctgggcc acgcgatgta cgccggcttc      1260
     accctgggtg ggctgcgggt gagcgtggac ggcgaggtcg agcgccccga cggctcggtg      1320
     atccccggcc tctacgccgc cggcgcctgc gcgtccaaca tcgcccagga cggcaagggc      1380
     tactgctcgg gcacccagct cggtgagggg tcgttcttcg gccgccggag cgggcgagcc      1440
     gccgctgcca gtgcgagcgc agcgagcacg ggcagcggat ag                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page