(data stored in SCRATCH zone)

EMBL: CP000509.PE292

CP000509.PE292       Location/Qualifiers
FT   CDS_pept        316135..316833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0297"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: fal:FRAAL5492
FT                   hypothetical protein; putative thiol:disulfide interchange
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79842"
FT                   /db_xref="GOA:A1SDF7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF7"
FT                   /protein_id="ABL79842.1"
FT                   /translation="MRDVDGAELSFDAWSGHKRVLVVWASWCGCRYELGGWQRLQAELA
FT                   DAGLRLFSVALDADPEDARPWIEAAAPTYPVGVDTAHVTAERYGITNVPSVVWVDERDR
FT                   IVKPPTIAPGDDRFVEFTRIESARHHDLLRAWVREGVLPEPAESAPERSDAEQLALAHR
FT                   RIAAHHQRSGRTGAAQAQLARAQELAPWDWTVRRGGIAMTGGDPFLGPEFTAFWEVWDA
FT                   AGRPGYTPTG"
     ttgcgcgacg tggacggcgc cgagctgtcc ttcgacgcct ggtccgggca caagcgggtg        60
     ctggtcgtct gggcgtcctg gtgcggctgt cggtacgagc tcggcgggtg gcagcgcctc       120
     caggccgagc tggccgacgc cggtctccgg ctgttctcgg tcgcgctgga cgcggacccc       180
     gaggacgcgc gaccctggat cgaggccgcg gccccgacgt acccggtcgg ggtcgacacc       240
     gcccacgtca ccgccgagcg gtacggcatc acgaacgtcc cgtcggtggt gtgggtggac       300
     gagcgggacc ggatcgtgaa gccgccgacg atcgcgcccg gggatgaccg gttcgtggag       360
     ttcacccgga tcgagagtgc ccgccaccac gacctgctgc gcgcctgggt gcgggagggc       420
     gtgctgcccg agccggccga gtccgccccc gaacggagcg acgccgagca gctcgcgctc       480
     gcgcaccggc ggatcgcggc ccaccaccag cggtccgggc gcaccggcgc ggcgcaggcc       540
     cagctcgccc gcgcccagga gctggcgccc tgggactgga cggtgcgccg tgggggcatc       600
     gcgatgacgg gcggtgaccc cttcctcggc ccggagttca ccgccttctg ggaggtgtgg       660
     gacgccgccg ggcgccccgg ctacacaccc accggctga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page