(data stored in SCRATCH zone)

EMBL: CP000509.PE294

CP000509.PE294       Location/Qualifiers
FT   CDS_pept        complement(318446..318946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pac:PPA2178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79844"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF9"
FT                   /protein_id="ABL79844.1"
FT                   /translation="MPQGARSAITISALGLLLVVAALWGWSAATDPLPAKVDTPICVDR
FT                   TVAAGTKVFAQDVTVSVYNAGTREGLAGRTMQLLTDDGFAEGNSGNVSARVEVVQIWTL
FT                   DPTNPAVQLVASRLGPDVEIERRDGPGAGISIVVGDGFQDLVEGRRSVQAEDDATICSP
FT                   PVG"
     atgccccagg gcgcgcggtc ggcgatcacg atctcggcgc tcggcctgct cctcgtggtg        60
     gccgccctct ggggctggtc cgcggccacg gacccgctcc cggccaaggt cgacacgccg       120
     atctgcgtgg accgcacggt cgcggccggc accaaggtgt tcgcccagga cgtcaccgtc       180
     agcgtctaca acgccggcac ccgggagggc ctggccgggc gcaccatgca gctgctcacc       240
     gacgacgggt tcgccgaggg caacagcggc aacgtcagcg cccgggtcga ggtggtccag       300
     atctggaccc tcgacccgac gaacccggcc gtccagctcg tggcgagccg actcggcccg       360
     gacgtcgaga tcgaacgccg cgacggcccc ggcgccggca tctcgatcgt ggtcggcgac       420
     ggcttccagg acctggtcga gggccgccgc tcggtgcagg ccgaggacga cgccacgatc       480
     tgcagcccgc cggtcggctg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page