(data stored in SCRATCH zone)

EMBL: CP000509.PE295

CP000509.PE295       Location/Qualifiers
FT   CDS_pept        complement(318946..319242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79845"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG0"
FT                   /protein_id="ABL79845.1"
FT                   /translation="MIFKRVGDGRPYPDHGLSSRAWAAVPPRQVRLDQLVTTKDTLQLA
FT                   ALLDEDSTFYGDLFAHVVEWRGDLYLEDGLHRALRAALQQRNVLHARVHTLED"
     gtgatcttca agcgcgtcgg cgacgggagg ccctaccccg accacgggct ctcgtcccgc        60
     gcgtgggcgg cggtcccgcc gcgacaggtc cgcctggacc agctcgtcac caccaaggac       120
     accctccagc tcgcggccct cctcgacgag gactccacgt tctacggcga cctgttcgcc       180
     cacgtggtcg agtggcgcgg cgacctctac ctcgaggacg ggctgcaccg cgcgctgcgc       240
     gccgccctcc agcagcgcaa cgtcctgcac gcccgggtcc acaccctgga ggactga          297
//

If you have problems or comments...

PBIL Back to PBIL home page