(data stored in ACNUC1104 zone)

EMBL: CP000509.PE297

CP000509.PE297       Location/Qualifiers
FT   CDS_pept        319580..320071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa48960 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79847"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG2"
FT                   /protein_id="ABL79847.1"
FT                   /translation="MAYQAAETGIRSSFVDDIDQICQLKYRYLRTLDTKRWDEFADCFL
FT                   PAATGDYDGLVFADRAALVAYLREHLGEGLLTLHQAHHPEIAVDGDTATGRWYLQDKVI
FT                   VPAFKFMLEGAAFYEDRYARTPDGWRVAHTGYRRTFEMTYDLADLPGLKINGPGEHTHV
FT                   "
     gtggcttacc aagcagccga aactggaata cgttctagtt tcgtggacga catcgaccag        60
     atctgtcagc tcaagtaccg ctacctgcgc accctggaca ccaagcgctg ggacgagttc       120
     gcggactgct tcctgcccgc ggccaccggc gactacgacg gcctggtctt cgccgaccgc       180
     gcggccctgg tcgcgtacct gcgagagcac ctcggcgagg ggctgctcac cctgcaccag       240
     gcccaccacc ccgagatcgc cgtcgacggc gacaccgcca ccggccggtg gtacctccag       300
     gacaaggtga tcgtccctgc gttcaagttc atgctcgagg gcgccgcgtt ctacgaggac       360
     cgctacgccc ggacgcccga cggctggcgg gtcgcccaca ccggctaccg ccgtaccttc       420
     gagatgacct acgacctcgc cgacctgccc ggcctgaaga tcaacggccc cggcgagcac       480
     acccacgtgt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page