(data stored in ACNUC1104 zone)

EMBL: CP000509.PE298

CP000509.PE298       Location/Qualifiers
FT   CDS_pept        complement(320191..324171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0303"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase;
FT                   KEGG: sco:SCO5734 ATP/GTP binding protein (membrane
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79848"
FT                   /db_xref="GOA:A1SDG3"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG3"
FT                   /protein_id="ABL79848.1"
FT                   /translation="MSTTLRGTRLDAPELPTGQVVLQPPPRIEPNEGASGVLMNAIPML
FT                   GSLGSIVLVATMGRASGGRGFLAAGMFLFATLGFIVVQLDRQRKQRTQQVSGSRTEYLR
FT                   YLANVRKVAREAADQQRRALTWQHPDPSALPALADERSRVWEHTTSDPTFLHVRYGVCA
FT                   QPLSLELVPPESTPIDQVDPAAASALHRLLVVHRLQPDLPASIDLRAFDRIEVCGPEEP
FT                   ARSLARSLICSATVFHSPDQLAVAVLTSEQHLARWDWLKWLPHAQSGRLSDAVGPMRMV
FT                   STSLADLAALLPADLGERPRFGADERPATPHLLLVVDDGELPPGNHVVPPDGLHGVTLL
FT                   DLPARWDDLEDATRLRLQLTAEPADDGRHPVLALRLREQPIRARADQCSIATAEALARR
FT                   LTPLHTIAAGGVEPGTGEIAGTADYLELLALGDVHTLDPATAWRPRPARDRLRVPIGLG
FT                   EGGSVVHLDIKESAQQGMGPHGLVIGATGSGKSEFLRTLVLGLALTHSPEQLNMVLVDF
FT                   KGGATFAGMADLPHVSAVITNLAQELTLVDRMQDALSGEMVRRQELLREAGNYASVRDY
FT                   ERARVAGEDLVPLPSLFIVVDEFSEMLSAKPEFIDLFVAIGRLGRSLGLHLLLASQRLE
FT                   EGRLRGLESHLSYRIGLRTFSAGESRTVLGVPDAYELPADPGLGYLKPDPATMLRFKAA
FT                   YVSGPPSGRVRVRRDEGGHLRGILPFTIAEVQALDVADPEPEPVAVEQPGDQESLLDLA
FT                   VRRMVGHGPAAHQVWLPPLDVPDTLDDLMPDLTEDPRHGLVSAHWRQLGGLIVPLGTAD
FT                   RPREQRRDTFTVDLGGSGGHAAVVGGPRSGKSTLLRTMVASISLTTTPQESQFFVLDFG
FT                   GGTFTPYADLPHVAGVGTRSEPDVVRRIVAEVRGVVDRREAYFRAHGIDSIETYRSRRA
FT                   AGRADDGYGDVFLVVDGWSTLRADFDDLELELQQLATRGLTFGLHLLVGAARWADFRAA
FT                   VRDLFGTRLELRLGDPMDSEIDRKVAALVPAGRPGRGLTASRLHFLAALPRVDGSADVE
FT                   ALGDGVDHLVKRVAAAWAGPTGPKLRLLPERIGLDDVRTLARPAAEDRRLLLGVTESDL
FT                   GPVALDGDAEPHLLVFGDGRSGKSALLRAYAREVMRTRTPQQAQLVVVDYRRSLLGEVP
FT                   EEYLVDYLTSARLAQPALQDLASYLESRIPGPDVTPDQLRNRSWWTGAEVFVLVDDYDL
FT                   VATQQGSPVQALQPLLPQARDLGLHLVVARRSGGASRALYEPVIQSLRDLAMPGLLLSG
FT                   SPDEGPLLGTHKPQPAPPGRGRLVTRDRGAEVVQLAWCEPSL"
     gtgagcacga cgctgcgcgg cacacgtctg gacgcgccgg agctgccgac cggccaggtg        60
     gtgctgcagc cgccaccgcg gatcgagccc aacgagggcg cgagcggcgt gctgatgaac       120
     gcgatcccga tgctcggcag cctgggctcc atcgtgctgg tcgccacgat gggccgcgcc       180
     agcggcggcc ggggcttcct cgccgcgggc atgttcctgt tcgcgaccct cggcttcatc       240
     gtggtccagc tggaccggca gcggaagcag cgcacgcagc aggtcagcgg atcgcgcacg       300
     gagtacctgc gctacctcgc gaacgtccgc aaggtcgccc gggaggcggc cgaccagcag       360
     cgccgggccc tcacctggca gcaccccgac ccgtccgcgc tgccggcgct cgccgacgag       420
     cggtcgcggg tctgggagca cacgacgtcc gacccgacct tcctgcacgt gcggtacggc       480
     gtgtgcgccc agccactgtc cctcgagctg gtgccgccgg agagcacgcc gatcgaccag       540
     gtcgacccgg ccgcggcctc ggcgctgcac cggctgctgg tcgtccaccg gctgcagccc       600
     gacctgcccg cctcgatcga cctgcgggcc ttcgaccgga tcgaggtgtg cggcccggag       660
     gagccggccc gctccctggc ccggtccctg atctgctccg ccaccgtctt ccactccccc       720
     gaccagctgg ccgtagcggt gctgacctcc gagcagcacc tggcgcgctg ggactggctc       780
     aagtggctgc cgcacgccca gagcgggcgg ctgtccgacg ccgtcggccc gatgcggatg       840
     gtgtccacct cgctcgccga cctggcggca ctgctgccgg cggacctcgg cgagcggccg       900
     cgcttcggcg ccgacgagcg acccgcgacg ccacacctgc tgctcgtcgt cgacgacggc       960
     gagctcccgc ccggcaacca cgtcgtacct cccgacggcc tgcacggcgt gacgctgctc      1020
     gacctgcccg cgcgctggga cgacctcgag gacgccaccc ggctgcgcct ccagctcacc      1080
     gcggagcccg ccgacgacgg ccgccacccg gtgctcgcgc tgcggctgcg ggagcagccg      1140
     atccgcgcca gggccgacca gtgcagcatc gcgaccgcgg aggcactggc gcgacggctc      1200
     acgccgctgc acacgatcgc cgccggcggc gtcgagccgg gcaccggcga gatcgccggg      1260
     acggccgact acctcgagct gctggcgctc ggcgacgtcc acacgctcga ccccgcgacc      1320
     gcctggcggc cgcgaccggc ccgcgaccgg ctgcgggtcc cgatcgggct cggcgagggc      1380
     ggctcggtcg tgcacctgga catcaaggag tcggcccagc agggcatggg tccccacggt      1440
     ctcgtgatcg gcgccaccgg ctccggcaag tcggagttcc tgcgcaccct ggtgctcggc      1500
     ctcgcgctca cccactcccc cgagcagctc aacatggtgc tcgtcgactt caagggcggt      1560
     gcgacgttcg cgggcatggc ggacctgccg cacgtctcgg cggtgatcac caacctcgcc      1620
     caggagctga ccctggtcga ccggatgcag gacgccctgt ccggggagat ggtccgccgc      1680
     caggagctgc tgcgggaggc cggcaactac gcctccgtcc gcgactacga gcgggcccgg      1740
     gtcgccggcg aggacctggt cccgctgccg tcgctgttca tcgtcgtcga cgagttctcc      1800
     gagatgctct cggcgaagcc ggagttcatc gacctgttcg tcgcgatcgg ccggctcggc      1860
     cgctccctgg gcctgcacct gctgctcgcg tcgcagcgcc tcgaggaggg ccggctgcgc      1920
     gggctggagt cgcacctctc ctaccggatc gggctgcgca ccttcagcgc cggcgagtcc      1980
     cgcaccgtcc tcggcgtgcc ggatgcctac gagctgccgg ccgacccggg gctcggctac      2040
     ctcaagccgg acccggccac gatgctgcgc ttcaaggcgg cctacgtctc cggcccgccg      2100
     tcgggccggg tgcgggtgcg ccgcgacgag ggcgggcacc tgcgcggcat cctgccgttc      2160
     acgatcgccg aggtgcaggc cctcgacgtg gccgatcccg agcccgagcc ggtcgccgtc      2220
     gagcagccgg gcgaccagga gtcgctgctc gacctcgccg tacgccggat ggtcgggcac      2280
     ggccccgcag cacaccaggt ctggctccca cccctggacg tccccgacac cctcgacgac      2340
     ctgatgccgg acctcaccga ggacccccgc cacggcctgg tctccgcgca ctggcgccag      2400
     ctcggcggcc tgatcgtgcc gctcgggacc gccgaccggc cccgcgagca gcgccgcgac      2460
     accttcaccg tcgacctggg cggctcgggc ggccacgcgg cggtggtcgg cggcccgcgc      2520
     agcggcaaga gcacgctgct gcgcacgatg gtcgcgagca tctcgctcac caccacgccc      2580
     caggagtcgc agttcttcgt cctcgacttc ggcggcggga cgttcacgcc gtacgccgac      2640
     ctgccgcacg tcgccggcgt cgggacccgc tcggagccgg acgtggtccg ccgcatcgtc      2700
     gcggaggtgc gcggggtcgt cgaccgccgc gaggcctact tccgggccca cggcatcgac      2760
     tccatcgaga cctaccgctc gcgccgggcc gccggccgcg ccgacgacgg atacggcgac      2820
     gtgttcctcg tggtcgacgg ctggagcacc ctgcgtgccg acttcgacga cctcgagctc      2880
     gagctccagc agctcgccac ccgtggcctc accttcggcc tgcacctgct ggtcggcgcg      2940
     gcccggtggg cggacttccg ggcggccgtg cgcgacctgt tcgggacccg tctcgagctg      3000
     cgcctcggcg acccgatgga ctccgagatc gaccgcaagg tcgccgcgct cgtgccggcg      3060
     ggtcggcccg gccggggcct gacggcgagc cggctgcact tcctcgccgc gctgccccgc      3120
     gtcgacggct ccgccgacgt ggaggccctc ggcgacgggg tggaccacct ggtcaagcgg      3180
     gtcgccgcgg cctgggccgg accgaccggc cccaagctgc ggctgctgcc ggagcggatc      3240
     ggcctggacg acgtacgcac cctggcgcgg cccgccgccg aggaccgccg cctgctcctc      3300
     ggcgtcaccg agtccgacct cggcccggtg gccctggacg gggacgccga gccgcacctg      3360
     ctggtgttcg gcgacggccg gtccggcaag agcgcgctcc tgcgcgccta cgcgcgcgag      3420
     gtgatgcgga cgcgcacacc ccagcaggcc cagctggtcg tcgtcgacta ccggcgctcg      3480
     ctgctcggcg aggtgcccga ggagtacctc gtcgactacc tcacctccgc ccgcctggcg      3540
     cagccggcgc tccaggacct cgcgtcctac ctcgagtccc gcatccccgg cccggacgtc      3600
     acccccgacc agctccgcaa ccgctcctgg tggacgggcg cggaggtgtt cgtgctcgtc      3660
     gacgactacg acctggtcgc cacccagcag ggctcgccgg tgcaggcgct gcagccgctg      3720
     ctgccccagg cccgcgacct cggcctgcac ctggtggtgg cccggcgctc cggcggcgcg      3780
     tcgcgggcgc tctacgagcc ggtgatccag tcgctgcgcg acctcgcgat gcccggcctg      3840
     ctgctctccg gcagccccga cgaggggccc ctcctcggca cccacaagcc gcagcccgcc      3900
     ccgcccggcc gcggccgcct ggtcacccgc gaccgcggtg ccgaggtcgt gcagctggcg      3960
     tggtgcgagc cgagcctgtg a                                                3981
//

If you have problems or comments...

PBIL Back to PBIL home page