(data stored in SCRATCH zone)

EMBL: CP000509.PE299

CP000509.PE299       Location/Qualifiers
FT   CDS_pept        324276..325691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79849"
FT                   /db_xref="GOA:A1SDG4"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG4"
FT                   /protein_id="ABL79849.1"
FT                   /translation="MAGTHAPADILALSVHGPVGVLDLVVPGTATAADVAEEYAVRAGL
FT                   DAAPVLRSRLGHGLEPATTLARAGVVTGDLLVADPSAPGVPADRAAEPVAGGRHAARSG
FT                   PAADGSPRPRPDTLPMLGLAVAAAAAGLAGWCAATAPGGALRATAIGLLLVAAVLGVLP
FT                   IGRRAAHRVVAAPAFGAAAAFAMAWDPHGVRLPMVLGVTGLAAALVAAVGRALAARPGE
FT                   ALRVWVLAGVAGFVGTGLASLGGAPPRLVWSLVLLGALLAARFVPAVAVDVPDQYLIDL
FT                   DRLAVTAWSAREQPSGRRGRTVVPLDAVDAVAARGTRIVTAASAAVLAAVLLSAPLLLA
FT                   AATLPIDRVGARVLVGCAGAGLLLAARSYRHAAARALLRIAGLACGTVLATALLGAAGR
FT                   AGWWLAGLAVLTAAALVVAAVAVGRGWRSAWWSRRAEVAEGLAGATAVGALVVASGWFR
FT                   QLWELASLWKLGA"
     gtggccggca cgcacgcacc cgcggacatc ctcgcgctct cggtccacgg cccggtcggc        60
     gtcctcgacc tggtcgtgcc gggcaccgcg acggccgcgg acgtcgccga ggagtacgcc       120
     gtccgcgccg gcctcgacgc cgccccggtg ctgcgaagcc gactgggcca cggcctcgag       180
     ccggcgacca cgctcgcccg cgccggggtc gtcaccggcg acctgctcgt cgccgacccg       240
     agcgcgccag gcgtccccgc cgaccgagcg gccgagccgg tggcgggcgg ccggcatgcg       300
     gcccggagcg gaccggccgc cgacggttcc ccgcggccgc gcccagacac cctgccgatg       360
     ctggggctcg cggtggccgc ggccgcggct gggctggccg gctggtgcgc cgccaccgcg       420
     ccgggcggcg cccttcgggc gacggccatc ggactcctgc tggtggcggc ggtgctcggg       480
     gtgctcccga tcggccggcg cgccgcccac cgggtcgtcg cggccccggc cttcggtgcg       540
     gccgccgcgt tcgcgatggc gtgggacccg cacggcgtgc ggctccccat ggtgctcggc       600
     gtcaccggcc tcgcggccgc cctggtcgcg gcggtcgggc gggcgctcgc ggcccgaccg       660
     ggtgaggcgc tccgggtatg ggtgctcgcg ggcgtcgccg ggttcgtcgg caccggcctc       720
     gcctcgctcg gcggagcgcc gccccggctg gtgtggtcgc tggtcctgct cggggcgctg       780
     ctcgccgcgc ggttcgtccc ggccgtcgcg gtcgacgtgc ccgaccagta cctcatcgat       840
     ctcgaccgcc tcgcggtcac cgcgtggtcc gcccgcgagc agccgagcgg ccgtcgcggg       900
     cgcaccgtcg tacccctcga cgcggtcgac gccgtcgcgg cccgcgggac ccggatcgtc       960
     acggccgcca gcgccgcggt gctcgcggcg gtcctgctgt ccgccccgct gctgctggcc      1020
     gccgcgacgc tgccgatcga ccgggtcggg gcgcgggtgc tggtcggttg cgcgggggcc      1080
     ggactcctcc tcgccgcccg cagctaccgt cacgcggccg cccgggcgct gctgcggatc      1140
     gccggcctgg cctgtggaac ggtgctggcg acggccctgc tgggcgctgc cggtcgggcc      1200
     ggctggtggc tcgccggcct cgcggtcctc accgccgcgg cgctcgtcgt cgcggccgtg      1260
     gcggtcggcc ggggttggcg ctccgcgtgg tggtcgcgcc gggccgaggt ggccgagggg      1320
     ctggccggcg cgacggcggt cggcgccctg gtcgtggcgt ccggatggtt ccgccagctc      1380
     tgggagctgg cgagcctgtg gaaactcgga gcctga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page