(data stored in ACNUC1104 zone)

EMBL: CP000509.PE3

CP000509.PE3         Location/Qualifiers
FT   CDS_pept        3332..4237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0003"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase,
FT                   NAD-binding; KEGG: sco:SCO3877 putative 6-phosphogluconate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79553"
FT                   /db_xref="GOA:A1SCL8"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCL8"
FT                   /protein_id="ABL79553.1"
FT                   /translation="MHIGLVGLGKMGGNMRTRLRDAGHTVVGFDRNPDLADVDSLEAMV
FT                   EQLPSPKVVWVMVPAGDPTRETIRRLGELLDEGDLVVDGGNSKWTDDQENADLLAQRGV
FT                   GFVDCGVSGGVWGAKFGYALMCGGSDEDVAKVQPAFDALKPDEGGFVHAGKKVGAGHFA
FT                   KMVHNGIEYAMMQSYAEGWELLEKVDLVDNVTEVFDSWRSGTVIRSWLLDLLVTALEED
FT                   GHLDQITGYADDSGEGRWTVQAAIDNAVPMHVIAASLFARFTSRQDDSPAMKAVAAMRN
FT                   QFGGHAVHTEPPVGGDANPG"
     atgcacatcg gactcgtcgg cctcggcaag atgggcggca acatgcgcac ccggctgcgc        60
     gatgccggcc acacggtggt gggcttcgac cgcaaccccg atctcgccga cgtcgacagc       120
     ctcgaggcga tggtcgaaca gctgccctcc cccaaggtgg tctgggtgat ggttcccgcc       180
     ggcgacccga cacgggagac gatccgccgg ctgggcgagc tgctcgacga gggtgacctg       240
     gtcgtcgacg gcggcaacag caagtggacc gacgaccagg agaacgccga cctcctcgcc       300
     cagcggggcg tcggcttcgt cgactgcgga gtctcgggcg gcgtgtgggg cgcgaagttc       360
     ggctacgccc tgatgtgcgg cggctccgac gaggacgtcg cgaaggtgca gcccgcgttc       420
     gacgcgctca agccggacga gggcggcttc gtgcacgcag gcaagaaggt cggcgcgggc       480
     cacttcgcga agatggtcca caacggcatc gagtacgcca tgatgcagag ctacgccgag       540
     ggctgggagc tgctggagaa ggtcgacctg gtcgacaacg tgaccgaggt gttcgactcc       600
     tggcgctccg gtaccgtcat ccggtcctgg ctcctcgacc tcctggtcac cgccctcgag       660
     gaggacgggc acctcgacca gatcaccggc tacgccgacg actcgggtga gggcaggtgg       720
     acggtgcagg ccgcgatcga caacgcggtc ccgatgcacg tgatcgctgc gtccctcttc       780
     gcccgcttca cctcccgcca ggacgacagc ccggcgatga aggcggtcgc cgcgatgcgc       840
     aaccagttcg gcgggcacgc cgtacacacg gagccgccgg tcggcggcga cgccaacccc       900
     ggctag                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page