(data stored in ACNUC1104 zone)

EMBL: CP000509.PE301

CP000509.PE301       Location/Qualifiers
FT   CDS_pept        326167..326463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0306"
FT                   /product="protein of unknown function DUF909"
FT                   /note="PFAM: protein of unknown function DUF909; KEGG:
FT                   cgb:cg0672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79851"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG6"
FT                   /protein_id="ABL79851.1"
FT                   /translation="MTLDGLRVNHAGLDTVADDLGQAVKRIDDRLNRLESELAPLRSDW
FT                   SGSAQQAYTAAKAKWDGAMQEMKGLLQETSSTVVQSNAEYRAADQRGAASFDI"
     atgactctcg acggacttcg cgtcaaccat gccggtctcg acaccgtcgc cgacgacctc        60
     ggccaggcgg tcaagcggat cgacgaccgg ctcaaccggc tcgagtcgga gctcgccccg       120
     ctgcgcagcg actggagcgg tagcgcccag caggcctaca ccgcggccaa ggccaagtgg       180
     gacggcgcca tgcaggagat gaaggggctg ctccaggaga ccagcagcac cgtggtgcag       240
     tcgaacgccg agtaccgcgc ggccgaccag cgcggcgcgg cctccttcga catctga          297
//

If you have problems or comments...

PBIL Back to PBIL home page