(data stored in ACNUC1104 zone)

EMBL: CP000509.PE302

CP000509.PE302       Location/Qualifiers
FT   CDS_pept        326594..327949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0307"
FT                   /product="CD9/CD37/CD63 antigen"
FT                   /note="TIGRFAM: CD9/CD37/CD63 antigen; KEGG: sma:SAV2527
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79852"
FT                   /db_xref="GOA:A1SDG7"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG7"
FT                   /protein_id="ABL79852.1"
FT                   /translation="MTQATAGRSGLVRVTVASGARRVDLVLPGAVPVAELVPELARSVG
FT                   LLDPATVYAGYRLVTAEGRRLAGDAGLVIQGVEDGGLLTVAAGVDDEPPRVYDDVVEAM
FT                   TDVVEHDLRPWEPASGRRTALVAAGLLMALGAVALLIQRGSLLAGATAVVVAVTLTAAA
FT                   VVLSRAQREAEAGVAVAWMATGYAAVAGLLLVTEDDPFFGLPVAAAGGAVLLTGLAGLV
FT                   GLGAGRALAIPPVVVGAVFLATGLVMRAAEFDPAAVLTSTLVLVVLAGSVLPWLALAVT
FT                   GTSVDPMYTVADVTAEPRPIDPARVAADARVAHEILVAVSATVGLLLVVVAPLAVSLGV
FT                   AGTVLAVLCCLVVMLRTRQYRTGSEVLVGLVSGVVGLLAVAASMLWLHPDWRPTAAVVL
FT                   AATGAALLALTMLPAPPSVRRGRLGDLAETVALLGLLPLLVLATGLFDAIRS"
     atgacccagg cgaccgccgg caggtccggc ctggtccggg tgacggtcgc ctccggcgcc        60
     cgccgcgtgg acctcgtcct gccgggcgca gtgccggtcg ccgagctggt tcccgagctg       120
     gcccgcagcg tcggcctgct cgacccggcc acggtctacg ccggctaccg tctcgtgacc       180
     gctgaggggc gccggctcgc gggcgacgcc ggcctggtga tccagggcgt cgaggacggc       240
     ggcctgctga cggtcgcggc cggtgtcgac gacgagccgc cccgcgtcta cgacgacgtc       300
     gtcgaggcga tgaccgacgt ggtcgagcac gacctgcggc cctgggagcc ggcgtcggga       360
     cgccgtaccg ccctcgtggc cgccggcctg ctgatggcgc tgggcgcggt ggcgctgctg       420
     atccagcgcg gctcgctgct cgccggcgcc acggcggtcg tggtcgcggt caccctgacg       480
     gccgcagcgg tcgtgctctc ccgtgcgcag cgcgaggccg aggccggggt cgcggtcgcc       540
     tggatggcga ccgggtacgc cgcggtcgcc gggctgctgc tggtgaccga ggacgacccg       600
     ttcttcgggc tgcccgtcgc ggccgcagga ggggccgttc tgctcaccgg gctggccggc       660
     ctcgtcggcc tcggcgcggg ccgcgccctg gcgatcccgc ccgtggtggt cggcgcggtc       720
     ttcctcgcga ccgggctggt gatgcgggcc gccgagttcg accccgcggc cgtgctcacg       780
     tcgacgctgg tcctggtggt gctcgccggg agcgtgctcc cgtggctggc cctggcggtg       840
     accggcacgt cggtcgaccc gatgtacacg gtcgcggacg tcaccgccga gccacggccg       900
     atcgacccgg cccgggtcgc cgcggacgcc cgcgtcgccc acgagatcct ggtcgccgtc       960
     tcggcgaccg tcggtctcct gctcgtcgtg gtggcgccac tggcggtctc gctgggcgtc      1020
     gccgggacgg tcctcgcggt gctgtgctgc ctggtcgtga tgctgcggac ccgccagtac      1080
     cgcaccggct cggaggtcct ggtcggcctg gtgtccgggg tggtcgggct gctcgcggtg      1140
     gcggcctcga tgctgtggct gcaccccgac tggcgcccca cggccgcggt cgtgctcgcc      1200
     gcgaccgggg cggcgctcct cgcgctgacc atgctgcccg cgccgccgtc ggtgcgccgt      1260
     gggcgcctcg gcgacctcgc cgagaccgtc gcgctgctgg gcctgctgcc gctgctcgtc      1320
     ctcgcgacgg gcctgttcga cgccatccgg tcctga                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page