(data stored in ACNUC1104 zone)

EMBL: CP000509.PE303

CP000509.PE303       Location/Qualifiers
FT   CDS_pept        327960..329408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79853"
FT                   /db_xref="GOA:A1SDG8"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG8"
FT                   /protein_id="ABL79853.1"
FT                   /translation="MATKKDLVEAYSFSRRRLVTAFVSGAPGGREVEPSRPGRTIIGGL
FT                   ALAVLLAAGAAIAGVLSPRTPDDWASNGLIVSKETGQAYVVLPAADGSAPEPDAPVELR
FT                   PVINITSARLILGADVEPMLISQDTIDDQRVGDDIGILGAPASLPAPGLLVETGWTACT
FT                   ADDRGMRVRVAVDPDVLPAPDAAQVVEVGGSFYLVASAQVGGDAAAAYALRLPGGDTVD
FT                   NLLGALDLPARVFAPTVPRGWLDLFPAGAALGWESFGLAGVGGRPDGWDAAQVPGRARV
FT                   GDVLRDATGDAVVLTADGPAELDPFALAVYSNTPIPGGGTPRVLPVDRFPDLARTRLPG
FT                   PDRHWPTTTVEPTETDPCAVLTTAGEEPAVVQLAQRPGPGYDARDVVPGHADVTVDPGR
FT                   GAYVRSASPEGARAPQPVAIDAKGRANPLDGDETAGLLGYADFPAPVVPDTWVKLFGAG
FT                   VPLSQNLALCPPAAAGAQDGPSCA"
     gtggccacca agaaggatct cgtcgaggcg tactcgttca gccggcgccg gctcgtcacg        60
     gcgttcgtct ccggagcgcc gggcggccgc gaggtcgagc cgagccgccc ggggcgcacc       120
     atcatcggcg gcctggcgct cgccgtgctg ctggcggccg gtgccgcgat cgcgggcgtc       180
     ctctccccgc ggacgccgga cgactgggcc agcaacgggc tgatcgtctc caaggagacc       240
     ggccaggcgt acgtcgtcct cccggccgcg gacggctcgg cgcccgagcc ggacgcgccg       300
     gtcgagctgc gcccggtcat caacatcacc tcggccaggc tgatcctcgg ggccgacgtc       360
     gagccgatgc tgatctccca ggacaccatc gacgaccagc gggtcggtga cgacatcggc       420
     atcctgggcg cgcccgccag cctgcccgcg cccggcctgc tggtggagac gggctggacc       480
     gcctgcacgg ccgacgaccg ggggatgcgg gtccgggtgg ccgtcgaccc cgacgtgctg       540
     cccgcgccgg acgccgccca ggtcgtcgag gtcggcggct ccttctacct ggtcgcctcc       600
     gcgcaggtcg gcggtgacgc ggcggcggcg tacgcgctcc ggctcccggg cggggacacc       660
     gtcgacaacc tgctcggcgc cctggacctg ccggcgcggg tgttcgcgcc gaccgtgccg       720
     cgcgggtggc tcgacctgtt cccggcgggc gccgcgctcg gctgggagag tttcgggctg       780
     gccggcgtgg gcgggcgacc ggacggctgg gacgcggccc aggtgccggg ccgcgcccgg       840
     gtgggcgacg tcctccggga cgccaccggc gacgccgtgg tgctgaccgc ggacgggccg       900
     gccgagctcg accccttcgc gctcgccgtc tacagcaaca cccccatccc cggcggtggc       960
     accccgcggg tgctcccggt cgaccggttc cccgacctgg ccaggacccg cctgcccggc      1020
     ccggaccggc actggccgac cacgacggtc gagcccacgg agaccgaccc ctgcgcggtg      1080
     ctgaccacgg caggcgagga gccggcggtc gtgcagctcg cgcagcgccc gggacctggc      1140
     tacgacgcac gcgacgtcgt gcccggccac gccgacgtga ccgtcgaccc gggccggggc      1200
     gcctacgtgc ggtccgcgag cccggagggc gcccgcgccc cgcagcccgt ggcgatcgat      1260
     gccaagggac gggccaaccc gctcgacggc gacgagaccg caggcctgct cggctacgcc      1320
     gacttccccg caccggtggt cccggacacc tgggtgaagc tgttcggcgc cggcgtaccg      1380
     ctctcgcaga acctcgcgct ctgcccgccc gccgcggccg gcgcccagga cggcccgtcg      1440
     tgcgcgtga                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page