(data stored in ACNUC1104 zone)

EMBL: CP000509.PE308

CP000509.PE308       Location/Qualifiers
FT   CDS_pept        334652..337108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0314"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: rha:RHA1_ro11210 probable
FT                   copper-exporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79858"
FT                   /db_xref="GOA:A1SDH3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH3"
FT                   /protein_id="ABL79858.1"
FT                   /translation="MATSAQHEHEHEHQHEHQHGAPHGAGTTTAVLEVSGVHWASSKSV
FT                   AEAVLSRQPGVLSVEANPVAQTATVTYDPRRTDLVRLRDWVRECGYHCAGRSVPRHVCD
FT                   PMAEPVPTEGHEGHEGHDGHRPEHDAMTHDATTQGGHAHGGHAHGGHAGMSMADMARDM
FT                   RNRFLVALVLSVPIALYSPMGRDMLGFDAATPFGLRDDVLALVLSLPVVLYSAWIFFDG
FT                   AWRALRARTLDMMVLVAVAVGAGWLYSLGVTLTGGGEVFYEAATMLTTFVLLGHWFEMR
FT                   ARGGANDAIRTLLDLAPPVAEVLRDGEVVTVPTAEVVIGDLLLVRPGSRIATDGLVEEG
FT                   ESEVDESMVTGESMPVAKGPGDAVIGATVNTTGTLRVRATKVGADTALAHIVALVQEAQ
FT                   NSKAPGQKLADRAAYWLVLVALVAGVGTFLTWLAVGRPVDEALLFAITVVVITCPDALG
FT                   LATPTAIMVGSGLGAKRGILFKNATAIESAARLDTVVMDKTGTLTRGEPEVTEVVLAPG
FT                   VDEHRLLALVGAVERESEHPLARAVVEHADHAGVPRLRATGFANVAGHGAVAEVDGHRV
FT                   VVGNRRLMDREGVALDVLAEQRETIASGGRTAILVAIDGAASAVVGLADAVRPTSAAAV
FT                   AALHEAGVQVVMLTGDNEATARRIADQLGIDDVIAEVLPEDKAAQVVALQRQGRRVAHV
FT                   GDGVNDAPALAAADVGIAIGAGTDVAIETADVVLMRSDPLDVPTALTIGRGTRRKELQS
FT                   LGWAIGYNAIALPVAAGVFEPALGLTLRPEVAAMTMSGSSILVAVNALLLKRLRLPEVG
FT                   RRHEHV"
     atggccacgt cggcccagca cgagcacgag cacgagcacc agcacgagca ccagcacggg        60
     gcgccgcacg gcgccgggac caccacggcg gtgctggagg tctcgggcgt ccactgggcg       120
     agcagcaaga gcgtcgccga ggcggtcctg tcgcggcagc ccggcgtgct ctcggtcgag       180
     gccaacccgg tcgcgcagac cgccacggtg acctacgacc cgcggcgcac cgatctggtc       240
     cggctgcggg actgggtgcg tgagtgcggg taccactgcg cgggtcgctc agtcccgcga       300
     cacgtctgcg acccgatggc cgagccggtc cccaccgaag gacacgaagg acacgaagga       360
     cacgacgggc accggcccga gcacgacgcg atgacgcacg acgcgacgac gcaaggcgga       420
     cacgcacacg ggggacacgc acacggggga cacgcaggga tgtccatggc cgacatggcc       480
     cgggacatgc gcaaccgctt cctggtcgcg ctcgtgctct cggtgccgat cgcgctgtac       540
     tcgccgatgg gacgcgacat gctcgggttc gatgcggcca cgccgttcgg gctccgcgac       600
     gacgtgctcg cgctggtgct gtccctgccg gtcgtcctct actccgcctg gatcttcttc       660
     gacggcgcct ggcgcgcgct gcgggcgcgc acgctcgaca tgatggtcct ggtcgcggtc       720
     gccgtgggtg ccggctggct ctactcgctc ggcgtgacgc tcaccggcgg cggcgaggtg       780
     ttctacgagg cggccacgat gctcaccacc ttcgtgctcc tcggccactg gttcgagatg       840
     cgggcccgcg gcggtgccaa cgacgccatc cgcaccctcc tcgacctggc tccgccggtg       900
     gccgaggtgc tccgcgacgg cgaggtcgtc acggtgccca ccgccgaggt cgtgatcggc       960
     gacctcctcc tggtccgtcc gggcagcagg atcgccaccg acggcctggt cgaggagggc      1020
     gagtccgagg tcgacgagtc gatggtgacc ggcgagtcga tgcccgtcgc gaaggggccc      1080
     ggcgacgcgg tcatcggcgc caccgtcaac accaccggca cgctgcgggt ccgggcgacc      1140
     aaggtcggcg cggacaccgc cctcgcccac atcgtcgccc tggtgcagga ggcgcagaac      1200
     tccaaggcgc ccggccagaa gctggccgac cgcgccgcct actggctcgt gctggtcgcc      1260
     ctggtcgccg gggtcggcac cttcctcacc tggctggctg tcgggcgacc ggtcgacgag      1320
     gccctgctct tcgcgatcac cgtcgtggtg atcacctgcc ccgacgcgct cgggctggcg      1380
     acaccgacgg cgatcatggt cgggtcgggc ctgggggcca agcgcggcat cctgttcaag      1440
     aacgcgaccg cgatcgagtc cgccgcgcgc ctcgacaccg tggtcatgga caagaccggg      1500
     acgctgaccc ggggtgagcc ggaggtcacc gaggtcgtcc tcgccccggg cgtcgacgag      1560
     caccggctcc tggcgctggt cggcgcggtc gagcgggagt cggagcaccc actggcgcgg      1620
     gccgtcgtcg agcacgccga ccacgccggc gtaccgaggc tccgggcgac cggtttcgcc      1680
     aacgtcgccg ggcacggcgc cgtcgcggag gtcgacggcc accgggtggt ggtcggcaac      1740
     cggaggctga tggaccgcga gggcgtcgcc ctcgatgtcc tggccgagca gcgggagacg      1800
     atcgcgagcg gcgggcgcac cgcgatcctc gtggcgatcg acggtgcggc cagcgcggtc      1860
     gtcgggctgg cggacgcggt ccgcccgacc tcggccgcgg cggtcgcggc actgcatgag      1920
     gccggagtac aggtcgtgat gctcaccggc gacaacgagg cgaccgcccg gcggatcgcc      1980
     gaccagctgg ggatcgacga cgtgatcgcg gaggtgctgc ccgaggacaa ggcggcccag      2040
     gtcgtggcgc tgcagcgcca gggccgtcgg gtcgctcacg tgggggacgg cgtcaacgac      2100
     gctcccgcgc tggcggccgc cgacgtcggg atcgcgatcg gtgccggcac cgacgtggcg      2160
     atcgagacgg ccgacgtcgt gctgatgcgc tcggacccgc tcgacgtccc gaccgccctg      2220
     accatcggcc ggggcacccg ccgcaaggag ctgcagtccc tgggctgggc gatcggctac      2280
     aacgcgatcg cgctgcccgt cgcggccggc gtgttcgagc cggcgttggg gctgacgctg      2340
     cggcccgagg tcgccgcgat gacgatgtcg ggctccagca tcctggtcgc cgtgaacgca      2400
     ctgctcctca agcggctgcg gctccccgag gtggggcgcc ggcatgagca tgtctag         2457
//

If you have problems or comments...

PBIL Back to PBIL home page