(data stored in ACNUC1104 zone)

EMBL: CP000509.PE31

CP000509.PE31        Location/Qualifiers
FT   CDS_pept        34746..35228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0031"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   bja:bll6394 putative monoamine oxidase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79581"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP6"
FT                   /protein_id="ABL79581.1"
FT                   /translation="MTPVRYWEDVEIGDSYTTPARTITETDVVMFAGLTGDYMPFHVDE
FT                   VTASRTIYGGRIAHGLLGLAYMQGMKTWVHTGIASMGSLGWTVDFRAPIRSGDTLTATF
FT                   TVASKRETSKPDRGILFVACELRNQDGVLVQEAEHRRMVRRRPADGEPGAPEGGRG"
     atgacccccg tccgttactg ggaggacgtc gagatcggcg actcctacac gactccggca        60
     cgaacgatca ccgagactga cgtggtcatg ttcgccgggt tgaccggtga ctacatgccg       120
     ttccacgtcg acgaggtgac cgcgagccgg acgatctacg gcgggcggat cgcccatggc       180
     ctcctgggcc tcgcctacat gcagggcatg aagacgtggg tgcacaccgg gatcgcgagc       240
     atggggtcgc tgggctggac cgtcgacttc cgagcgccga tccggtccgg tgacaccctg       300
     accgcgacgt tcacggtggc gagcaagcgc gagacgagca agccagaccg cggcatcctg       360
     ttcgtggcct gtgagctgcg caaccaggat ggcgtcctgg tgcaggaggc cgagcaccgg       420
     cggatggtgc ggcgtcgtcc ggccgacggc gagcccgggg cgcccgaggg cggccgcgga       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page