(data stored in SCRATCH zone)

EMBL: CP000509.PE310

CP000509.PE310       Location/Qualifiers
FT   CDS_pept        complement(337850..339403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0316"
FT                   /product="oxidoreductase, molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding; KEGG:
FT                   mpa:MAP2359c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79860"
FT                   /db_xref="GOA:A1SDH5"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH5"
FT                   /protein_id="ABL79860.1"
FT                   /translation="MMMHPILQAATSSTELGFPWWLQVTHLVNFLFLGLLVRSGWEILA
FT                   SHPRLYWRNDCGPDTEWLKFTKDKVPSEIGAFTARDDQRDLHPLISLPGRAKIGIGRAW
FT                   HGLITTLWVLNGLIYVVLLFGTGQWRRLIPTSWSVFPEAWDSLKIYAGFGVPSIEHFQP
FT                   YDALQQLMYTFVVFVLAPLMIVTGPVMSPAVVGRYPWYPKLFGGRQAARSLHFLGMAFF
FT                   VVFAVMHVALVLLVHREHNLVHMMMGEEYDAALVGQAVTRVIVGVVVVVALWIAASYVS
FT                   LIDVRKSQRVLYGLQAPIKKLVLNPMTSRQRARQVFTEDDISPFHWVNTRPPDLSQSPE
FT                   WLALRDGGFRDFRLEVGGLVREPRSFSLDELREIAAQDQITMHTCMQGWTGIAKWSGIP
FT                   LREVLAQVEPLEGADYVMIESFGTAQHMHDGRPVEPYYTVLTKAMAMEDETILAWGMNG
FT                   APLPEMYGAPLRLRTESMHGYKMVKWVRSVSWIHDYKEVGDGMGGTREDSGYQDMDARI
FT                   "
     atgatgatgc acccgattct gcaggccgcc acgtcctcga cggagctcgg cttcccgtgg        60
     tggctgcagg tgacccacct ggtcaacttc ttgttcctgg gtctgctggt ccggtccggc       120
     tgggagatcc tcgcctcgca cccgcggctc tactggcgca acgactgcgg gccggacacc       180
     gagtggctga agttcaccaa ggacaaggtt ccctcggaga tcggggcctt caccgcacgt       240
     gatgaccagc gcgacctgca cccgctgatc agtctcccgg gccgggccaa gatcggcatc       300
     ggtcgcgcct ggcacgggtt gatcaccacc ctgtgggtgc tcaacgggct catctacgtg       360
     gtgctgctgt tcggcaccgg ccagtggcga cgactgatcc cgacctcgtg gagcgtgttc       420
     ccggaggcct gggactcgct gaagatctac gccggattcg gggtcccctc gatcgagcac       480
     ttccagccgt acgacgccct gcagcagctg atgtacacgt tcgtggtgtt cgtgctggcg       540
     ccgctgatga tcgtcaccgg tccggtgatg tcgccggcgg tcgtgggccg ctacccgtgg       600
     tacccgaagc tcttcggcgg ccgccaggcc gcgcgctcgc tgcacttcct cggcatggcg       660
     ttcttcgtgg tgttcgcggt catgcacgtc gcgctcgtgc tcctggtgca ccgcgagcac       720
     aacctcgtgc acatgatgat gggcgaggag tacgacgccg ccctggtcgg ccaggccgtc       780
     acccgggtga tcgtcggggt cgtcgtggtg gtcgcgctgt ggatcgcggc gtcgtacgtc       840
     tcgctgatcg acgtgcggaa gagccagcgg gtgctctacg gcctgcaggc gccgatcaag       900
     aagctcgtgc tgaacccgat gacctcgcgg cagcgggccc ggcaggtgtt caccgaggac       960
     gacatctcgc cgttccactg ggtcaacacc cggccgccgg acctgagcca gtcgccggag      1020
     tggctcgcgc tgcgcgacgg cggcttccgc gacttccggc tcgaggtcgg cggcctggtc      1080
     cgggaaccgc ggtccttctc gctcgacgag ctcagggaga tcgcggccca ggaccagatc      1140
     accatgcaca cctgcatgca gggctggacc ggcatcgcga agtggtcggg tatcccgctg      1200
     cgtgaggtgc tcgcccaggt cgagccgctc gaaggcgccg actacgtgat gatcgagtcc      1260
     ttcgggaccg cccagcacat gcacgacgga cggccggtgg agccctacta caccgtgctc      1320
     accaaggcga tggcgatgga ggacgagacg atcctcgcct ggggcatgaa cggtgcgccg      1380
     ctgcccgaga tgtacggcgc cccgctgcgg ctgcgcaccg agtccatgca cggctacaag      1440
     atggtcaagt gggtccgttc ggtgtcctgg atccatgact acaaggaggt cggcgacggg      1500
     atgggcggca cccgcgagga ctccggctac caggacatgg acgccaggat ctga            1554
//

If you have problems or comments...

PBIL Back to PBIL home page