(data stored in ACNUC1104 zone)

EMBL: CP000509.PE313

CP000509.PE313       Location/Qualifiers
FT   CDS_pept        342619..343218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0319"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="KEGG: sco:SCO3618 putative recomination protein;
FT                   TIGRFAM: recombination protein RecR; PFAM: RecR protein;
FT                   TOPRIM domain protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79863"
FT                   /db_xref="GOA:A1SDH8"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SDH8"
FT                   /protein_id="ABL79863.1"
FT                   /translation="MYEGVVQDLIDELGRLPGVGPKGAQRIAFHLLQADPADVRRLADV
FT                   LLEVKAKVKFCSICFNVSQDDQCRICRDPRRDPSVLCVVEEYKDVVAIERTREFRGRYH
FT                   VLGGAISPIDGVGPEQLRIRELMVRLADGTITEVILATDPNLEGEATATYLTRMLKPLE
FT                   LRVTRLASGLPVGGDLEYADEVTLGRAFAGRRSADD"
     ttgtacgagg gcgtcgtcca ggacctgatc gacgagctcg gtcggctgcc gggcgtcggt        60
     cccaagggcg cgcagcggat cgcgttccac ctgttgcagg ccgaccccgc cgacgtacgc       120
     cgcctcgccg atgtgctgct cgaggtgaag gcgaaggtca agttctgcag catctgcttc       180
     aacgtctccc aggacgacca gtgccggatc tgccgcgacc cgcggcgcga cccgtcggtg       240
     ctgtgcgtgg tcgaggagta caaggacgtg gtcgccatcg agcggacccg tgagttccgc       300
     ggccgctacc acgtgctcgg cggggccatc tcgccgatcg acggggtcgg accggagcag       360
     ctgcggatcc gggagctgat ggtgcggctg gccgacggca cgatcaccga ggtgatcctg       420
     gcgaccgacc ccaacctcga gggggaggcg actgcgacct acctcacccg gatgctcaag       480
     cccctggagt tgcgcgtgac gcggcttgcg agtggactgc cagtaggcgg tgatctggag       540
     tacgccgacg aggtgaccct gggccgcgcg ttcgcaggaa ggcgatcagc agatgactga       600
//

If you have problems or comments...

PBIL Back to PBIL home page