(data stored in ACNUC1104 zone)

EMBL: CP000509.PE314

CP000509.PE314       Location/Qualifiers
FT   CDS_pept        343211..343804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV4558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79864"
FT                   /db_xref="InterPro:IPR032025"
FT                   /db_xref="InterPro:IPR038312"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH9"
FT                   /protein_id="ABL79864.1"
FT                   /translation="MTETTIDHETEEFAQQIADQVESFLIALQAIAREADGGRAISLLL
FT                   LEISQVLLAGARLGAQRDFKPEGEYQPDVGPEPDLDEMRLRLASMLDSVDTYSFVFDPY
FT                   VPDVVESQLSDDLTSIATDLENGLRHYRLGNVDEALWWWQFSYVASWGNLAGAALNALL
FT                   SIVAHDRLDAEFTGEDEQLALADEMLEGGEPTAR"
     atgactgaga ccacgatcga ccacgagacc gaggagttcg cccagcagat cgccgaccag        60
     gtcgagagct tcctgatcgc gttgcaggcc atcgcccgcg aggccgacgg cggccgggcg       120
     atctcgctgc tgctgctgga gatcagccag gtgctgctcg cgggcgcccg gctgggcgcg       180
     cagcgcgact tcaagcccga gggcgagtac cagcccgacg tcgggccgga gcccgatctc       240
     gacgagatgc ggctgcggct ggcgtcgatg ctcgacagcg tcgacaccta cagcttcgtg       300
     ttcgacccct acgtccccga cgtggtggag agccagctct ccgacgacct gaccagcatc       360
     gccaccgacc tcgagaacgg gctgcgccac taccggctcg gcaacgtcga cgaggcgctg       420
     tggtggtggc agttctcgta cgtcgcctcc tggggcaacc tcgcgggcgc cgctctcaac       480
     gcgctgttgt cgatcgtggc gcacgaccgc ctggacgccg agttcaccgg cgaggacgag       540
     cagctcgcgc tcgccgatga gatgttggag ggtggcgagc ccaccgctcg gtag             594
//

If you have problems or comments...

PBIL Back to PBIL home page