(data stored in ACNUC1104 zone)

EMBL: CP000509.PE315

CP000509.PE315       Location/Qualifiers
FT   CDS_pept        343857..345131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0321"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: tfu:Tfu_0043 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; aspartate kinase, monofunctional class;
FT                   PFAM: aspartate/glutamate/uridylate kinase; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79865"
FT                   /db_xref="GOA:A1SDI0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI0"
FT                   /protein_id="ABL79865.1"
FT                   /translation="MGIVVQKYGGSSVADAAGIKRVAQRIVNTRKAGHDVVVVVSAMGD
FT                   ETDNLRDLAEQVTPLPPPRELDMLLTAGERISMALVAMAIAALGHEAKSFTGSQAGVIT
FT                   DSAHGKAKIIDITPGRIEKALKDGAIAIVAGFQGVSQDTKDVTTLGRGASDTTAVALAA
FT                   ALGAEVCEIYSDVDGVFTADPRIVPAARKLARVSTEEMLEMAASGAKILHLRCVEYARR
FT                   YDMPIHVRSSFSQKEGTWVIPDSKAGEDEMEQAIIAGVAHDRSEAKITVVGVPDKVGEA
FT                   ARIFEALAATEVNLDMVVQNVSAAATGLTDISFTLPRADGQSAMGALARIQDEVGYDKL
FT                   LYDDQIGKVSLIGAGMRSHPGITARFFASLAAAGVNIEMISTSEIRISVIVDEAQVDEA
FT                   VRATHTAFDLDAEEVEAVVYGGTGR"
     gtgggcattg tcgtccagaa gtacggcgga tcgtcggtcg cggacgccgc cggcatcaag        60
     cgggtggccc agcggatcgt caacacccgc aaggccggcc acgacgtcgt cgtggtcgtc       120
     tcggccatgg gagacgagac cgacaacctg cgcgatctcg ccgagcaggt gacgccgctg       180
     ccgccgccgc gggagctgga catgctgctg accgccggcg agcggatctc gatggcgctg       240
     gtcgcgatgg ccatcgccgc gctcgggcac gaggcgaagt cgttcaccgg ctcgcaggcg       300
     ggcgtgatca ccgactccgc ccacggcaag gcgaagatca tcgacatcac gccgggccgg       360
     atcgagaagg ccctcaagga cggcgccatc gcgatcgtcg ccggcttcca gggcgtctcc       420
     caggacacca aggacgtcac cacgctcggc cgcggcgcct cggacacgac cgcggtcgcg       480
     ctcgccgccg cgctcggtgc cgaggtctgc gagatctaca gcgacgtcga cggcgtcttc       540
     accgcggacc cccggatcgt gcccgcggcc cgcaagctcg cccgggtctc gaccgaggag       600
     atgctggaga tggcggcctc gggcgccaag atcctgcacc tgcggtgcgt cgagtacgcc       660
     cgccgttacg acatgccgat ccatgtgcgc tcctccttca gccagaagga aggcacctgg       720
     gtcatcccgg acagcaaggc aggagaggac gagatggagc aggcgatcat cgccggcgtc       780
     gcccacgacc ggagcgaggc caagatcacc gtggtcggcg tgccggacaa ggtcggcgag       840
     gcggcccgga tcttcgaggc gctggccgcg accgaggtca acctcgacat ggtcgtccag       900
     aacgtctccg cggcggccac cggcctgacc gacatctcct tcacgctgcc gcgcgcggac       960
     gggcagagcg cgatgggcgc cctggcgcgg atccaggacg aggtcggcta cgacaagctg      1020
     ctctacgacg accagatcgg caaggtctcg ctgatcgggg cgggcatgcg ctcccacccc      1080
     ggcatcaccg cgcgcttctt cgcctcactc gccgcggcgg gcgtcaacat cgagatgatc      1140
     tccacctccg agatccggat ctcggtgatc gtcgacgagg cccaggtcga cgaggcggtg      1200
     cgcgccacgc acaccgcgtt cgacctcgac gccgaagagg tcgaggcggt cgtgtacggc      1260
     gggaccggtc gatga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page