(data stored in ACNUC1104 zone)

EMBL: CP000509.PE317

CP000509.PE317       Location/Qualifiers
FT   CDS_pept        complement(346350..347027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79867"
FT                   /db_xref="GOA:A1SDI2"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI2"
FT                   /protein_id="ABL79867.1"
FT                   /translation="MADGEPEQDADQHTDRDQPSLELPRLGWRRRRRTQEAPEPQPEPH
FT                   AGQQAELHAGQQAGQAREGTRPLVEETAPRTVAAPVRAAEPAAEPEPEREPKVRRPGGL
FT                   PVVVLTGVVVGLGIVGLTWASLRLCESVQGTSSCGDAGYGLLIVILVVMVILGALLLRL
FT                   ARVPEPGSTSFLAVGLTSVLALVFLVDSLMDRPMVVVIPLISAATFTLAHWVTRTFTGP
FT                   AAG"
     atggccgatg gggagcccga gcaggacgcc gaccagcaca ccgacaggga ccagccgtcg        60
     ctcgagctgc cccggctggg ctggcggcgc cgccggcgta cccaggaggc gcccgagccg       120
     cagcccgagc cgcacgccgg gcagcaggcc gagctgcacg ccgggcagca ggccgggcag       180
     gcccgagaag ggacgcggcc gctcgtcgag gagaccgcgc cacgcaccgt ggccgcgccc       240
     gtgcgcgcgg ccgagccggc ggccgagccc gagcccgagc gggagccgaa ggtgcgccga       300
     cccggcgggc tgccggtggt ggtcctcacc ggcgtggtcg tcggcctcgg gatcgtcggc       360
     ctcacctggg cctcgctacg gctgtgcgag agcgtccagg gcacgtcctc gtgtggcgac       420
     gccggctatg ggctgttgat cgtgatcctc gtggtgatgg tgatcctcgg cgcgctgctg       480
     ctgcgcctgg cgcgggtgcc cgagcccggc agcaccagct tcctcgcggt cgggctcacc       540
     tcggtgctcg cgctggtgtt cctggtcgac tcgctgatgg accgcccgat ggtcgtggtg       600
     atcccgctga tcagcgccgc cacgttcacc ctcgcccatt gggtgacccg cacgttcacc       660
     ggcccggccg cgggctga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page