(data stored in ACNUC1104 zone)

EMBL: CP000509.PE319

CP000509.PE319       Location/Qualifiers
FT   CDS_pept        348333..348797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0325"
FT                   /product="GatB/Yqey domain protein"
FT                   /note="PFAM: GatB/Yqey domain protein; KEGG: tfu:Tfu_0108
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79869"
FT                   /db_xref="GOA:A1SDI4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI4"
FT                   /protein_id="ABL79869.1"
FT                   /translation="MSALKERLRADLTASMKARDEVRSSTLRMVLTAITNAEVAGKEHR
FT                   ELSDDDIIGVLSTEAKKRREAAAAFGEGGREEMAAKETAEAAVIADYLPAQLSEQEIAD
FT                   LVTSAIAQTGAAGEGMRAMGKVMGMIQPQVKGRADGGVVAAEVRRQLGAS"
     atgagcgcgc tcaaggagcg tctgcgcgcc gacctgaccg cctcgatgaa ggcccgcgac        60
     gaggtgcgct cctcgacgct gcggatggtg ctcaccgcga tcaccaacgc cgaggtggcc       120
     ggcaaggagc accgcgagct ctccgacgac gacatcatcg gcgtgctgtc caccgaggcg       180
     aagaagcggc gcgaggccgc ggctgcgttc ggcgagggcg ggcgcgagga gatggccgcg       240
     aaggagaccg ccgaggcggc cgtcatcgcc gactacctgc ccgcccagct cagcgagcag       300
     gagatcgccg acctggtgac ctccgcgatc gcccagaccg gagcggccgg ggagggcatg       360
     agggcgatgg gcaaggtcat gggcatgatc cagccccagg tcaagggccg cgccgacggt       420
     ggtgtcgtgg ccgcggaggt acgccgccag ctcggcgcgt cctga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page