(data stored in ACNUC1104 zone)

EMBL: CP000509.PE32

CP000509.PE32        Location/Qualifiers
FT   CDS_pept        35225..36823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0032"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; KEGG:
FT                   mka:MK0828 succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79582"
FT                   /db_xref="GOA:A1SCP7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP7"
FT                   /protein_id="ABL79582.1"
FT                   /translation="MSAPGVDRVEVDLVVAGGGVGGAMAAYHAARVGARVLYLGGSGGA
FT                   SARISSFNTALGYDDPDTPDGIVEDMLRAGRHVNHPGVVRALADRVAEETMRLVEMDVP
FT                   FVRDGDRLARRQAAGSTWTRAVFSRGMIGADIVRALTERLVADESVTVVNGGLLVDVET
FT                   ADGAVCGVLAWSPRDERWMQIGTRAVVMATGGAGQLWASTTNPRGSLGTGYAVALEAGA
FT                   ELMDMEFTSFEPFITSAPPEHAGHDLPTTVLREGARLLNARGEAFLPEQSPTKDIICRA
FT                   MVREVLEGRGTASGSVVFDLTEMDPDNAERYVGIVEALRKRGITSREAQLEVMPAQHYV
FT                   MGGIRIDERGRSTLPGMYAVGEAAGGAHGAHRLAAGGGLEVVAGGAVVGEAAGLDALSA
FT                   TGDRRCSLAPNPDLLSVRLAAEAQADLGLIRGAMDSGCGILRTATDLEDTVTAVEEVHQ
FT                   RHRVPGGHPFVRRAAMVALSIARSAAMREESRGDHFRTDHPHSSEEWLANIVVTAPAGE
FT                   MEFTTAPVPTATTVA"
     atgagcgcgc ccggagtgga ccgggtcgag gtcgacctgg tggtcgcggg tggcggtgtc        60
     ggtggcgcga tggcggcata ccacgccgcg cgcgtgggcg ccagggtgct ctacctcggt       120
     ggctctggtg gcgcctccgc acgcatcagc agcttcaaca ccgccctggg ctacgacgat       180
     cccgacaccc ccgacgggat cgtcgaggac atgctccggg ccggccggca cgtcaaccat       240
     cccggcgtgg tccgggcgct cgccgaccgc gtcgcggagg agacgatgcg cctggtcgag       300
     atggacgtcc ccttcgtgcg cgacggggac cggctggcca ggcggcaggc ggccggcagc       360
     acgtggaccc gcgccgtgtt ctcgcgaggg atgatcggcg ccgacatcgt ccgggcgctg       420
     accgagcggc tcgtcgcgga cgaatcagtg acggtggtga acggcggcct gctggtcgac       480
     gtcgagaccg cggacggtgc ggtgtgcggt gtcctcgcct ggagcccccg cgacgagcgg       540
     tggatgcaga tcggaacgcg cgcggtcgtg atggcgaccg gtggggcggg ccagctgtgg       600
     gcgtcgacga ccaacccgcg cggcagcctg ggcaccgggt acgccgtggc cctcgaggcc       660
     ggcgccgagc tgatggacat ggagttcacc tccttcgagc cgttcatcac gtcggcgccc       720
     cccgagcacg cgggtcacga cctccccacg accgtgttgc gggagggcgc gcgcctgctc       780
     aacgctcgag gcgaggcctt cctgcccgag cagagcccca ccaaggacat catctgccgg       840
     gcgatggtcc gtgaggtgct ggaggggcgc ggcaccgcct cgggctcggt cgtcttcgac       900
     ctgacggaga tggacccgga caacgccgag cgctacgtcg gcatcgtcga ggcgttgcgc       960
     aagcgcggga tcacgagccg tgaggcgcag ctcgaggtga tgccggccca gcactacgtc      1020
     atgggcggga tccggatcga cgagcgcggc cgctccacgt tgccggggat gtacgcggtc      1080
     ggagaggcgg ccggcggggc gcacggtgcc caccggctcg ccgccggcgg tggcctcgag      1140
     gtggtcgccg ggggcgcggt ggtgggcgag gccgcaggcc tggatgccct gtccgcgacc      1200
     ggcgaccggc gctgctcgct ggcgccgaac ccggacctgc tcagcgtccg gctggcggcc      1260
     gaggcgcagg ccgacctcgg cctgatccgt ggggccatgg actcggggtg cggcatcctg      1320
     cggaccgcca ccgacctcga ggacaccgtg acggccgtcg aggaggtcca ccagcggcac      1380
     cgggtgccgg gcgggcaccc gttcgtccgg cgggccgcga tggtcgcact ctcgatcgcc      1440
     cggtcggccg cgatgcgcga ggagtcgcgc ggcgaccact tccgcaccga tcacccccac      1500
     agctccgagg aatggctcgc caacatcgtg gtgacggccc cggcgggcga gatggagttc      1560
     acgaccgcgc ccgtcccgac cgcgacgacc gtggcctag                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page