(data stored in SCRATCH zone)

EMBL: CP000509.PE324

CP000509.PE324       Location/Qualifiers
FT   CDS_pept        354203..354976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0330"
FT                   /product="3-oxoacid CoA-transferase, A subunit"
FT                   /EC_number="2.8.3.5"
FT                   /note="KEGG: fal:FRAAL3148 succinyl-CoA:3-ketoacid-coenzyme
FT                   A transferase subunit A (succinyl CoA:3-oxoacid
FT                   CoA-transferase) (OXCT A); TIGRFAM: 3-oxoacid
FT                   CoA-transferase, A subunit; PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79874"
FT                   /db_xref="GOA:A1SDI9"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI9"
FT                   /protein_id="ABL79874.1"
FT                   /translation="MDKVVASATAAVADIPDGVTLSVGGFGLCGIPSVLIQAVLDRGTQ
FT                   DLEVVSNNAGVDGWGLGLLLGAGRLRRVVASYVGENKEFARQYLSGELEVELTPQGTLA
FT                   ERMRAGGSGIPAFFTATGVGTQVAEGGLPWRYDAEGAVVKSSPAKQTQVFETAEGPKEF
FT                   VLEHAIVADFGLVRAWKGDRHGNLVFRDSARNFNPLAAMCGRVTIAEVEHLVEPGELDP
FT                   NQVHTPGVFVQRVVELTPEQAADKRIEKKTVRARG"
     gtggacaagg tggtggcgtc ggcgacagcc gcggtggcgg acatcccgga cggggtgacg        60
     ctgtccgtcg gtgggttcgg gttgtgcggg atcccctcgg tgctgatcca ggcggtgctc       120
     gaccgcggca cccaggacct ggaggtggtc tcgaacaacg ccggcgtgga cgggtggggc       180
     ctgggcctgc tcctcggcgc cgggcggctg cggcgggtgg tggcgtcgta cgtcggggag       240
     aacaaggagt tcgcccgcca gtacctctcc ggcgagctgg aggtggagct gaccccgcag       300
     ggcacgctcg cggagcggat gcgtgccggc gggtcgggga tcccggcgtt cttcaccgcg       360
     accggcgtgg gcacccaggt ggccgagggc gggctgccgt ggcgctacga cgccgagggg       420
     gcggtggtga agtcctcgcc ggccaagcag acccaggtct tcgagaccgc ggaggggccc       480
     aaggagttcg tgctcgagca cgcgatcgtc gcggacttcg gcctggtgcg ggcctggaag       540
     ggcgaccgcc acggcaacct ggtgttccgc gactcggctc gcaacttcaa cccgttggcg       600
     gcgatgtgcg ggcgggtcac gatcgcggag gtcgagcacc tggtcgagcc gggtgagctc       660
     gaccccaacc aggtgcacac cccgggggtg ttcgtgcagc gggtggtgga gctgaccccg       720
     gagcaggccg cggacaagcg gatcgagaag aagacggtga gggcacgcgg atga             774
//

If you have problems or comments...

PBIL Back to PBIL home page