(data stored in ACNUC1104 zone)

EMBL: CP000509.PE326

CP000509.PE326       Location/Qualifiers
FT   CDS_pept        complement(355713..356549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0332"
FT                   /product="RNA polymerase, sigma 28 subunit, SigD/FliA/WhiG"
FT                   /note="PFAM: sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70, region 4 type 2; KEGG: lxx:Lxx06230 RNA
FT                   polymerase, sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79876"
FT                   /db_xref="GOA:A1SDJ1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ1"
FT                   /protein_id="ABL79876.1"
FT                   /translation="MTIAERDQLAVQHVPLVAHLVRETMARVPSYMDRNDLHSAGLLAL
FT                   VQAARAFDPERGVPFAGYASTRIRGALVDELRSVDWASRSVRRRAREIEAARARLAATL
FT                   GQFPDDAAVAEALGITPEEIGKADSEVARAVVLPLDAGPNAGFVESLAGRDPGPEEEAL
FT                   HAERAQYLAAAIEELPERLRHVVRGYFVAQRPMAELAAELGVSESRISQLRAEALVLLR
FT                   DALAEAFEPHLAAPHPNPDGVAARRRLAYTSAVAARYAARRTMPAARVREGLSSIA"
     atgacaatcg cggagcgcga ccagctcgcc gtccagcacg tgccgctggt ggcgcacctg        60
     gtgcgcgaga ccatggcgcg ggtgccgtcg tacatggacc gcaacgacct gcactccgca       120
     ggcctcctcg cgctcgtcca ggccgcccgc gccttcgacc ccgagcgcgg ggtgccgttc       180
     gccggctacg cctccactcg gatccgcggc gcgctggtcg acgagctgcg ctcggtggac       240
     tgggcctcgc gctcggtgcg ccgccgtgcc cgggagatcg aggcggcacg ggcccgcctg       300
     gccgcgacct tgggtcagtt ccccgacgac gccgcggtcg ccgaggccct ggggatcacc       360
     ccggaggaga tcggcaaggc cgactccgag gtggcccggg ccgtggtgct gccgctcgac       420
     gcgggcccga acgcggggtt cgtcgagagc ctggccggtc gcgaccccgg ccccgaggag       480
     gaggcgctgc acgccgagcg cgcgcagtac ctcgcggccg cgatcgagga gcttcccgag       540
     cggctgcgcc acgtggtgcg cggctacttc gtcgcgcagc ggccgatggc cgagctggcc       600
     gccgagctcg gggtcagcga gtctcggatc tcgcagctgc gcgccgaagc actggtgctc       660
     ctgcgcgacg ccctcgccga ggccttcgag ccgcacctgg ccgcgccgca cccgaacccc       720
     gacggtgtcg cggctcggcg ccggctcgcc tacaccagcg ccgtcgccgc ccggtacgcc       780
     gcccgccgga cgatgcccgc cgcccgcgtc cgcgaggggc tcagctcgat cgcctag          837
//

If you have problems or comments...

PBIL Back to PBIL home page