(data stored in ACNUC1104 zone)

EMBL: CP000509.PE327

CP000509.PE327       Location/Qualifiers
FT   CDS_pept        356811..357617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0333"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="PFAM: sigma-70 region 4 domain protein; KEGG:
FT                   lxx:Lxx06230 RNA polymerase, sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79877"
FT                   /db_xref="GOA:A1SDJ2"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ2"
FT                   /protein_id="ABL79877.1"
FT                   /translation="MPERARLCLTCRVTINAPGPAPTVDPARLAAHHLPLVAHLVYDTL
FT                   RRVPAAVDRHDLLAVGVDALLAAAREPTVERPFAEHASVRIRAALVEELRAIDWAARAE
FT                   HPRHAASARARLLAALADLPDAGAAARVLDVDHDPAEAEEGSPAVVGGTTRPAHPDRRD
FT                   ERREYVEAALDELPERLRLVVRGYFVEQRPMAAVAAQVGASEARAVQLLVEGLGLLRDA
FT                   LALAFGPSADAGPVTSTRAASYARTVAARYAARPVRAPREEQRTSA"
     ttgcccgaac gtgcccgttt atgcctcact tgtcgggtga cgatcaacgc ccctggaccc        60
     gccccgaccg tcgacccggc ccggctcgcc gcccatcatc tgccgctggt ggcccatctg       120
     gtgtacgaca cgctgaggcg ggtgccggca gccgtcgatc gtcacgacct gctcgccgtc       180
     ggggtcgacg ccctcctggc tgcggcgcgc gagcccacgg tggagcgccc cttcgccgag       240
     cacgcctcgg tccggatccg cgccgccctc gtcgaggagc tgcgcgcgat cgactgggcg       300
     gcgcgggcgg agcacccccg ccacgcggcc tcggcccggg cccggctcct cgccgccctc       360
     gccgacctgc ccgacgccgg ggcggccgcg cgcgtgctgg acgtcgacca cgatccggcc       420
     gaggccgagg aggggagccc cgcggtcgtg ggcggcacca cgcgtcccgc ccaccctgat       480
     cggcgcgacg agcgccggga gtacgtcgag gccgccctgg acgagctccc cgaacgactc       540
     cggctcgtcg tgcgcggcta cttcgtcgag cagcggccga tggccgcggt ggctgcccag       600
     gtcggcgcca gcgaggcgcg ggcggtccag ctcctggtcg aagggctggg actgctgcgc       660
     gatgcgctgg cgctggcctt cgggccctcc gccgacgcgg gtcccgtcac gagcacccgg       720
     gcagcgtcgt acgcccgcac cgtcgccgcc cgctacgccg cccgccccgt gcgcgcgccc       780
     cgggaggagc agcggacctc cgcctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page