(data stored in SCRATCH zone)

EMBL: CP000509.PE330

CP000509.PE330       Location/Qualifiers
FT   CDS_pept        358987..359451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0336"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: sco:SCO3575
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79880"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ5"
FT                   /protein_id="ABL79880.1"
FT                   /translation="MTSPEERLAELGLAVPDVAKPVAVYVPAVVSGDLVFTSGQLPMRD
FT                   GELMVTGKVGGEVSPEEAALCAQQCALNAIAAVKSMVGDLDRVAQVVKVVAFVASTPDF
FT                   TGQPQVANGASELFGKVFGDRGAHARSAVGVPVLPLDAPVEVEIVVRVAS"
     atgacgtccc cggaggagcg gctcgccgag ctcggcctgg cggtgccgga cgtggccaag        60
     ccggtggcgg tgtacgtgcc cgccgtggtg tccggcgacc tggtgttcac ctccgggcag       120
     ctgccgatgc gcgacggtga gctgatggtg accggcaagg tcggcggcga ggtgagcccc       180
     gaggaggcgg ccctgtgcgc gcagcagtgt gcgctgaacg cgatcgcggc ggtgaagtcg       240
     atggtgggcg acctcgaccg ggtcgcccag gtcgtcaagg tcgtcgcctt cgtcgcgtcg       300
     acccccgact tcacgggcca gccacaggtc gccaacggcg cctcggagct gttcgggaag       360
     gtgttcggcg acaggggcgc gcacgcccgc tccgccgtcg gcgtgccggt gctgccgctg       420
     gatgcgcccg tcgaggtcga gatcgtggtg cgggtggcct cgtga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page