(data stored in ACNUC1104 zone)

EMBL: CP000509.PE331

CP000509.PE331       Location/Qualifiers
FT   CDS_pept        359462..360334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0337"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sma:SAV4589
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79881"
FT                   /db_xref="GOA:A1SDJ6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ6"
FT                   /protein_id="ABL79881.1"
FT                   /translation="MRIPIPPIPLPEQIVELAREYDDGRRDPAEPRDAATVILVRPSDH
FT                   GPAVYYLRRHTTMEFAGGMCVYPGGGVDPRDFDTTVAWAGPAPAEWAERLGCDEEMARA
FT                   LVCAAVRETFEESGVLLAGPSADEVVADTTGEDWEADRHALESRELAMTAFLSARGLVL
FT                   RTDLLGVWGGWLTPAFEPKRYRTWFFVALLPEGQRTRDVSTESESVTWLPAADAVAQAE
FT                   RGEMLMMPPTYLTSLEVAQLATPDEVIVAAHGRVVEMHTPVVEPLDGEGWTLSVPAHHR
FT                   SILAAHRGA"
     gtgaggatcc cgatcccgcc gatcccgctc ccggagcaga tcgtcgagct cgcccgcgag        60
     tacgacgacg gcaggcgcga cccggccgag ccccgggacg cggccaccgt gatcctggtc       120
     cgcccctccg accacggtcc ggcggtgtac tacctgcgcc ggcacaccac gatggagttc       180
     gccgggggca tgtgcgtgta ccccggcggt ggggtggacc cccgcgactt cgacacgacc       240
     gtcgcctggg ccggtcccgc gcctgccgag tgggccgagc gcctgggctg cgacgaggag       300
     atggcgcgcg cgctggtgtg cgcggcggtg cgcgagacct tcgaggagtc cggcgtcctg       360
     ctggccgggc cgtccgccga tgaggtcgtc gccgacacca cgggcgagga ctgggaggcc       420
     gaccggcacg ccctggagtc gcgggagctc gcgatgaccg cgttcctctc cgcacggggc       480
     ctggtgctgc gcaccgacct gctcggtgtc tggggcggct ggctgacccc cgccttcgag       540
     ccgaagcgct accgcacctg gttcttcgtc gcgctgctgc ccgaggggca gcggacccgg       600
     gacgtctcga ccgagtccga gtcagtgacc tggctgccgg cagccgacgc ggtggcccag       660
     gccgagcgcg gcgagatgct gatgatgccg ccgacgtatc tcacctcgct cgaggtcgcg       720
     cagctcgcca ccccggacga ggtgatcgtg gcggcgcacg gccgggtggt ggagatgcac       780
     acccccgtcg tcgagccgct cgacggcgag ggctggacgc tgtccgtgcc ggcccaccac       840
     cgctcgatcc tggccgcgca ccgcggcgcc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page