(data stored in SCRATCH zone)

EMBL: CP000509.PE332

CP000509.PE332       Location/Qualifiers
FT   CDS_pept        360390..361157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0338"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sco:SCO3572 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79882"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ7"
FT                   /protein_id="ABL79882.1"
FT                   /translation="MLAANPGPMTLDGTNTWVLREPGARRSVVVDPGPALPAHLDAIAA
FT                   EAGEVGVVLLTHHHADHAEAARAFAERVGCGVRALDPAYRLGAEGLGDGDVVAVDGLEI
FT                   RVVGTPGHTADSLSFLLPAEGAVLTGDTVLGRGTTVVAHPDGQLGAYLGSLDRLHALAE
FT                   AHEVASIWPGHGPVIVNALGALDHYLAHRQERLEQVRAAVETLQAAHRPEGIAAEELPR
FT                   RVVEIVYADVDPVLWGAAELSVRAQLAYLAEPR"
     gtgctcgccg ccaaccccgg cccgatgacc ctcgacggga ccaacacctg ggtgctgcgg        60
     gaacccgggg cgcgccgctc ggtcgtcgtg gacccgggcc cggccctccc cgcccacctc       120
     gacgcgatcg cggcggaggc cggcgaggtc ggcgtggtcc tgctgaccca ccaccacgcg       180
     gaccatgccg aggcggcacg ggcgttcgcc gagcgggtgg ggtgcggcgt ccgggccctg       240
     gacccggcgt accgcctcgg cgccgagggg ctcggcgacg gagacgtcgt cgccgtcgac       300
     ggcctggaga tccgggtggt cggcacgccg gggcacaccg ccgactcgct gtccttcctg       360
     ctgcccgcgg agggggcggt gctcacggga gacaccgtgc tcggccgcgg aaccaccgtc       420
     gtcgcgcacc ccgacggcca gctgggcgcc tacctcggct cgctcgaccg gctgcacgcg       480
     ctcgccgagg cgcacgaggt cgcgtcgatc tggcccggcc acggcccggt catcgtcaac       540
     gcgctcggcg ccctggacca ctacctcgcc caccgccagg agcggctcga gcaggtgcgc       600
     gccgcggtgg agacgctgca ggccgcgcac cgtcccgagg ggatcgcggc cgaggagctg       660
     ccccgcaggg tggtcgagat cgtctacgcc gacgtcgacc cggtgctctg gggtgccgcc       720
     gagctgtccg tgcgggcgca gctggcctac ctggccgagc cgcgctga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page