(data stored in SCRATCH zone)

EMBL: CP000509.PE336

CP000509.PE336       Location/Qualifiers
FT   CDS_pept        363420..364139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0342"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sma:SAV4594
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79886"
FT                   /db_xref="GOA:A1SDK1"
FT                   /db_xref="InterPro:IPR000059"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK1"
FT                   /protein_id="ABL79886.1"
FT                   /translation="MIPDWLVPVRDGAAAISADQLTRFTPPAGGDARRGAVLMLFGAGE
FT                   QGGELLLTERAHDMRSHPGQVSFPGGALDPGETPVEAALREAEEEVGVDPASVEVFGRL
FT                   PELWLPPSNFAVTPVLGWWREPGDVSIVSQAEVHAIHHVPISELLDPEHRITVRHPRGG
FT                   YQSPGFLIGPDHDVVLWGFTGGIIARLFDFLGWTRPWDESRLRDLPSYMLQADPRRGRL
FT                   LDIEDDQDDDQDEEEDG"
     gtgatccccg actggctggt gccggtccgc gacggcgcgg ccgccatctc ggccgaccag        60
     ctcaccaggt tcacccctcc ggcgggtgga gacgcccggc gtggagcggt gctgatgctg       120
     ttcggcgcgg gcgagcaggg cggcgagctg ctgctcaccg agcgggccca cgacatgcgc       180
     tcccaccccg gtcaggtctc cttcccgggt ggcgcgctcg acccgggcga gacccccgtc       240
     gaggccgcgc tccgcgaggc cgaggaggag gtcggggtgg acccggcctc ggtcgaggtg       300
     ttcggccggc tgcccgagct gtggctaccg ccgagcaact tcgcggtcac cccggttctc       360
     ggctggtggc gcgagcccgg cgacgtgagc atcgtcagcc aggccgaggt gcacgcgatc       420
     caccacgtcc cgatcagcga gctgctcgac cccgagcacc ggatcaccgt ccgccacccc       480
     cggggcggct accagagccc gggcttcctg atcggccccg accacgacgt cgtcctctgg       540
     ggcttcacgg gcgggatcat cgcccgcctc ttcgacttcc tcggctggac ccggccgtgg       600
     gacgagtcgc gcctgcgcga cctgccgtcg tacatgctgc aggctgaccc acgacgcggt       660
     cggctcctcg acatcgagga cgaccaggac gacgaccagg acgaggagga ggacgggtga       720
//

If you have problems or comments...

PBIL Back to PBIL home page