(data stored in SCRATCH zone)

EMBL: CP000509.PE337

CP000509.PE337       Location/Qualifiers
FT   CDS_pept        364136..365311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0343"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap; Colicin
FT                   V production protein; KEGG: fra:Francci3_4292 colicin V
FT                   production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79887"
FT                   /db_xref="GOA:A1SDK2"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK2"
FT                   /protein_id="ABL79887.1"
FT                   /translation="MNLLDWLLVVLVLAYALSGYWQGFITGAFATGGLLLGGLFGVWLA
FT                   PVALGDANPSLMVSLGALFIVILSASLGQAVLQFAGARIRERITWQPARALDAVGGAML
FT                   SAVAVLVVAWALGVAISGSRIGGVTPLVRGSTVLSHVDEVMPASADGALQAFNDVVGTS
FT                   FFPRYLEPFAPERIVEVGPGPKRLLNDPDVERAGSSVLKIRGTNECGRGVEGSGFLYAG
FT                   NRLMTNAHVVAGIDDPEVIVGDESVPADVVYYNPDIDVAVLSFDSGDLPALRFDRDAGA
FT                   PDGVAILGYPQDGPYHVEPARIRSEQRLRSPNIYGDGAVIREVYSLRGRILPGNSGGPI
FT                   VSSAGDVVGVVFAASVTDHETGYALTAGQVSAAAAAGLTSSSQVSTGGCAG"
     gtgaacctgc tcgactggct cctggtcgtg ctcgtgctcg cctacgcgct ctccggctac        60
     tggcagggct tcatcaccgg tgccttcgcg accggggggc tgctgctcgg cggactgttc       120
     ggcgtgtggc tggccccggt cgcactgggt gacgccaacc cctccctgat ggtctccctg       180
     ggcgcgctgt tcatcgtgat cctgtccgcg tcgctggggc aggccgtgct ccagttcgcc       240
     ggcgcccgga tccgcgagcg gatcacctgg cagccggccc gcgccctcga cgcggtcggc       300
     ggcgccatgc tcagcgccgt ggcggtcctc gtggtcgcct gggcgctcgg cgtcgcgatc       360
     tcggggtctc ggatcggcgg cgtcaccccg ctggtgcggg gctcgaccgt gctctcccac       420
     gtcgacgagg tgatgcccgc cagcgccgac ggcgcgctgc aggcgttcaa cgacgtcgtc       480
     ggcaccagct tctttccccg ctacctcgag ccgttcgcgc ccgagcggat cgtcgaggtc       540
     ggacccggcc ccaagcggct gctcaacgac cccgacgtcg agcgcgccgg gtcgagcgtc       600
     ctcaagatcc gcggcaccaa cgagtgtggc cggggtgtcg aggggtccgg gttcctgtac       660
     gccggcaacc ggctgatgac caacgcccac gtcgtcgccg ggatcgacga ccccgaggtc       720
     atcgtcggcg acgagtcggt cccggcggac gtcgtctact acaaccccga catcgacgtg       780
     gcggtgctct ccttcgacag cggggacctg ccggctctgc gcttcgaccg cgacgccggc       840
     gcgcccgacg gtgtcgcgat cctgggctac ccgcaggacg ggccctacca cgtggagccc       900
     gcccggatcc gctccgagca gcggctccgc tcacccaaca tctacggcga cggcgcggtg       960
     atccgtgagg tctactccct gcgcgggcgg atcctgccgg gcaactccgg cgggccgatc      1020
     gtgtcctcgg ccggcgacgt cgtcggcgtg gtgttcgccg cctcggtcac cgaccacgaa      1080
     accggctacg cgctgaccgc cggacaggtc tccgccgccg cggccgccgg cctgaccagc      1140
     tcgagccagg tgtcgaccgg cggttgtgct gggtga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page