(data stored in SCRATCH zone)

EMBL: CP000509.PE338

CP000509.PE338       Location/Qualifiers
FT   CDS_pept        complement(365473..365892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0344"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   cdi:DIP0309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79888"
FT                   /db_xref="GOA:A1SDK3"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK3"
FT                   /protein_id="ABL79888.1"
FT                   /translation="MASNQVQAAPPDEGDPTIGRLVHDASRDISTLIQKEIQLAKSELK
FT                   VSVQAGGIGIGLFAAAGFIAVLAVIMLSVAIAYFINWNGDGLALHWAFLIVFGFYLLLA
FT                   GLMVFVGIRKVKQVRAPERAIEQGREIPKALKGRS"
     atggcgagca accaggtcca ggctgcacct ccggatgagg gcgatccgac catcggtcgt        60
     ctggtccacg acgccagccg ggacatctcc acgctgatcc agaaggagat ccagctggcc       120
     aagtccgagc tgaaggtcag cgtgcaggcc ggcggcatcg ggatcggcct cttcgcggct       180
     gccggcttca tcgcggtcct cgcggtcatc atgctgtcgg tcgccatcgc gtacttcatc       240
     aactggaacg gcgacggcct cgccctgcac tgggcgttcc tcatcgtctt cggcttctac       300
     ctgctgctcg cgggcctgat ggtgttcgtc ggcatccgca aggtcaagca ggtccgcgcc       360
     ccggagcggg cgatcgagca gggccgcgag atccccaagg cgctcaaggg tcgcagctga       420
//

If you have problems or comments...

PBIL Back to PBIL home page