(data stored in ACNUC1104 zone)

EMBL: CP000509.PE341

CP000509.PE341       Location/Qualifiers
FT   CDS_pept        complement(369471..371075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0347"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: sco:SCO1822 putative
FT                   transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79891"
FT                   /db_xref="GOA:A1SDK6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK6"
FT                   /protein_id="ABL79891.1"
FT                   /translation="MSSDTLTAILFIGVVLITIAITFWASRQNKGTADFYAAGRSFSGF
FT                   QNGMAISGDYMSAASFLGISGAIALYGYDGFLYSIGFLVAWLVALLLVAELLRNSGRYT
FT                   MADQLAYRMRQRPVRTAASTSTVVVSIFYLLAQMVGAGALVALLLGADSEAAKNATIIG
FT                   VGVLMIFYVTVGGMKGTTWVQIVKAVLLMGGTILITILVLAKFNFNISDLLGAAAANTG
FT                   KGDAFLQPGLKYGIDTTAKIDFLSLGLALVLGTAGLPHILIRFYTVPSAKAARTSVLWA
FT                   IGLIGAFYLMTLALGFGAAALLDTGAGSKVAASGGNLASPLLAEAVGGGDGTTGGAVLL
FT                   ALISAVAFATILAVVAGLTLTSASSVAHDLYATVFKKGAATERDEVRVARLSAFVIGGI
FT                   AIALAIPAQKLNIAFLVALAFAVAASANLPSLIYNLFWRRFNTRGATWAIYGGLIASVG
FT                   LVFFSPVVSGSETALFTGQDWSYFPLSNPGIISIPLGFFFGWLGTVTSQEPESAARFTE
FT                   LEVRAFTGAGAEQAVRH"
     atgagctccg acaccctgac cgcgatcctg ttcatcgggg tcgtcctgat caccatcgcc        60
     atcacgttct gggcgagccg acagaacaag ggcaccgcgg acttctacgc cgccggccgt       120
     tccttcagtg gcttccagaa cggcatggcg atctccggcg actacatgtc ggcggcgtcg       180
     ttcctcggca tctcgggcgc catcgcgctg tacgggtacg acgggttcct ctactcgatc       240
     ggcttcctgg tggcctggct ggtcgccctg ctgctggtcg ccgagctgct gcgcaactcc       300
     ggccgctaca cgatggccga ccagctggcc taccggatgc ggcagcgccc ggtccggacc       360
     gcggcgtcca cctcgaccgt ggtggtctcg atcttctacc tgctcgccca gatggtcggc       420
     gcgggggccc tggtcgcact gctcctcggc gcggactccg aggcagccaa gaacgccacg       480
     atcatcgggg tcggcgtgct gatgatcttc tacgtcaccg tcggcggcat gaagggcacc       540
     acctgggtgc agatcgtcaa ggcggtgctg ctgatgggcg gcaccatctt gatcacgatc       600
     ctggtgctgg cgaagttcaa cttcaacatc tccgacctgc tcggcgcggc tgcggccaac       660
     accggcaagg gcgacgcctt cctccagccg ggactgaagt acgggatcga cacgaccgcg       720
     aagatcgact tcctcagcct cggcctcgcg ctggtgctcg gtacggcggg cctgccgcac       780
     atcctgatcc gcttctacac cgtgccgagc gccaaggcgg cgcgcacctc ggtgttgtgg       840
     gcgatcgggc tgatcggcgc gttctacctg atgacgctcg cgctcggctt cggtgccgcg       900
     gcgctgctcg acaccggtgc cgggagcaag gtggcggcgt ccggcggcaa cctcgcctca       960
     ccactgctcg ccgaagccgt cggcggtggc gacgggacca cgggcggcgc ggtcctgctg      1020
     gcgctgatct ccgccgtcgc gttcgcgacg atcctggcgg tcgtcgcggg cctgacgctc      1080
     acctcggcgt cgtccgtggc ccacgacctc tacgcgacgg tcttcaagaa gggtgcggcg      1140
     accgagcgcg acgaggtacg ggtggcccgg ctctcggcgt tcgtgatcgg tggcatcgcg      1200
     atcgcgctgg ccatcccggc gcagaagctc aacatcgcgt tcctcgtggc gctggccttc      1260
     gcggtcgccg cctcggcgaa cctgccctcg ctgatctaca acctgttctg gcgccgcttc      1320
     aacacccgcg gtgccacctg ggcgatctac ggcggcctga tcgccagcgt gggcctggtg      1380
     ttcttctcgc cggtcgtgtc cggctcggag acggcgctgt tcaccggtca ggactggtcg      1440
     tacttcccgc tcagcaaccc cggcatcatc tcgatcccgc tcggcttctt cttcgggtgg      1500
     ctcggcaccg tcacctccca ggagccggag agcgccgcgc ggttcaccga gctcgaggtc      1560
     cgggccttca ccggcgcggg cgccgagcag gccgtccggc actga                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page